PDB entry 4c4r

View 4c4r on RCSB PDB site
Description: Structure of beta-phosphoglucomutase in complex with a phosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride
Class: isomerase
Keywords: phosphoryl transfer, transition state, metal fluoride, mutase, isomerase
Deposited on 2013-09-09, released 2014-07-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-10, with a file datestamp of 2014-09-05.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.1504
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-phosphoglucomutase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71447 (0-End)
      • conflict (124)
      • conflict (205)
    Domains in SCOPe 2.07: d4c4ra_
  • Heterogens: MG, YO5, MGF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c4rA (A:)
    mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
    fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
    sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c4rA (A:)
    mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
    fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
    sgalpigvgrpedlgddivivpdtshytleflkevwlq