PDB entry 4c3r

View 4c3r on RCSB PDB site
Description: Structure of dephosphorylated Aurora A (122-403) bound to AMPPCP
Class: transferase
Keywords: transferase, aurora a, activation, cell cycle, cancer
Deposited on 2013-08-26, released 2014-05-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-06-11, with a file datestamp of 2014-06-06.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: 0.22939
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4c3ra_
  • Heterogens: ACP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c3rA (A:)
    eskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrre
    veiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitela
    nalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemi
    egrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlis
    rllkhnpsqrpmlrevlehpwitansskpsncqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c3rA (A:)
    qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs
    hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy
    chskrvihrdikpenlllgsagelkiadfgwsvhgtldylppemiegrmhdekvdlwslg
    vlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlre
    vlehpwitanss