PDB entry 4c3q

View 4c3q on RCSB PDB site
Description: Neutron structure of a perdeuterated Toho-1 R274N R276N double mutant Beta-lactamase in complex with a fully deuterated boronic acid (BZB) at 100K
Class: hydrolase
Keywords: hydrolase, toho-1, perdeuterated neutron structure, extended-spectrum beta lactamases, ctx- m-type esbls, cryogenic neutron
Deposited on 2013-08-26, released 2014-07-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-07-09, with a file datestamp of 2014-07-03.
Experiment type: NEUT
Resolution: 2.2 Å
R-factor: 0.1944
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactamase toho-1
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47066 (0-260)
      • engineered mutation (244)
      • engineered mutation (246)
    Domains in SCOPe 2.05: d4c3qa_
  • Heterogens: BZB, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4c3qA (A:)
    nsvqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesd
    khllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdk
    vtafarslgdetfrldrteptlntaipgdprdtttplamaqtlknltlgkalaetqraql
    vtwlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpe
    qkaenrndilaaaakivthgf