PDB entry 4c3p

View 4c3p on RCSB PDB site
Description: Structure of dephosphorylated Aurora A (122-403) bound to TPX2 and AMPPCP
Class: transferase
Keywords: transferase, activation, allostery, cell cycle, cancer
Deposited on 2013-08-26, released 2014-05-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-06-11, with a file datestamp of 2014-06-06.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: 0.20526
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4c3pa_
  • Chain 'B':
    Compound: Targeting protein for Xklp2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4c3pd_
  • Chain 'E':
    Compound: Targeting protein for Xklp2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c3pA (A:)
    eskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrre
    veiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitela
    nalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemi
    egrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlis
    rllkhnpsqrpmlrevlehpwitansskpsncqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c3pA (A:)
    krqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrevei
    qshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanal
    sychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegr
    mhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrll
    khnpsqrpmlrevlehpwitanss
    

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4c3pD (D:)
    eskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrre
    veiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitela
    nalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemi
    egrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlis
    rllkhnpsqrpmlrevlehpwitansskpsncqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c3pD (D:)
    krqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrevei
    qshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanal
    sychskrvihrdikpenlllgsagelkiadfgwsvhaplcgtldylppemiegrmhdekv
    dlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsq
    rpmlrevlehpwitansskp
    

  • Chain 'E':
    No sequence available.