PDB entry 4c2v

View 4c2v on RCSB PDB site
Description: Aurora B kinase in complex with the specific inhibitor Barasertib
Class: transferase/cell cycle
Keywords: transferase-cell cycle complex, azd1152
Deposited on 2013-08-20, released 2014-02-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.16817
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aurora kinase b-a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4c2va_
  • Chain 'B':
    Compound: aurora kinase b-a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4c2vb_
  • Chain 'C':
    Compound: inner centromere protein a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: inner centromere protein a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: YJA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c2vA (A:)
    qntalaempkrkftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegve
    hqlrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsat
    fmeeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldy
    lppemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdg
    skdliskllryhppqrlplkgvmehpwvkansrrvlppvyqstqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2vA (A:)
    kftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehqlrreieiqs
    hlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfmeeladalhy
    cherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylppemiegkth
    dekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgskdliskllry
    hppqrlplkgvmehpwvkansrrvlppvyqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4c2vB (B:)
    qntalaempkrkftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegve
    hqlrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsat
    fmeeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldy
    lppemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdg
    skdliskllryhppqrlplkgvmehpwvkansrrvlppvyqstqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2vB (B:)
    qntalaempkrkftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegve
    hqlrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsat
    fmeeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldy
    lppemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdg
    skdliskllryhppqrlplkgvmehpwvkansrrvlppvyq
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.