PDB entry 4bzq

View 4bzq on RCSB PDB site
Description: Structure of the Mycobacterium tuberculosis APS kinase CysC in complex with ADP and APS
Class: transferase
Keywords: transferase, sulfur assimilation, ADP
Deposited on 2013-07-29, released 2014-08-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bifunctional enzyme cysn/cysc
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bzqa_
  • Chain 'B':
    Compound: bifunctional enzyme cysn/cysc
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bzqb_
  • Heterogens: ADX, ADP, CIT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bzqA (A:)
    pprgktvwftglsgsgkssvamlverkllekgisayvldgdnlrhglnadlgfsmadrae
    nlrrlshvatlladcghlvlvpaisplaehralarkvhadagidffevfcdtplqdcerr
    dpkglyakarageithftgidspyqrpknpdlrltpdrsideqaqevidlles
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bzqB (B:)
    pprgktvwftglsgsgkssvamlverkllekgisayvldgdnlrhglnadlgfsmadrae
    nlrrlshvatlladcghlvlvpaisplaehralarkvhadagidffevfcdtplqdcerr
    dpkglyakarageithftgidspyqrpknpdlrltpdrsideqaqevidlles