PDB entry 4bzp

View 4bzp on RCSB PDB site
Description: Structure of the Mycobacterium tuberculosis APS kinase CysC in complex with ADP
Class: transferase
Keywords: transferase, sulfur assimilation
Deposited on 2013-07-29, released 2014-08-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bifunctional enzyme cysn/cysc
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bzpa_
  • Chain 'B':
    Compound: bifunctional enzyme cysn/cysc
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bzpb_
  • Heterogens: ADP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bzpA (A:)
    spprgktvwftglsgsgkssvamlverkllekgisayvldgdnlrhglnadlgfsmadra
    enlrrlshvatlladcghlvlvpaisplaehralarkvhadagidffevfcdtplqdcer
    rdpkglyakarageithftgidspyqrpknpdlrltpdrsideqaqevidlles
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bzpA (A:)
    pprgktvwftglsgsgkssvamlverkllekgisayvldgdnlrhglnadlgfsmadrae
    nlrrlshvatlladcghlvlvpaisplaehralarkvhadagidffevfcdtplqdcerr
    dpkglyakarageithftgidspyqrpknpdlrltpdrsideqaqevidlles
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bzpB (B:)
    spprgktvwftglsgsgkssvamlverkllekgisayvldgdnlrhglnadlgfsmadra
    enlrrlshvatlladcghlvlvpaisplaehralarkvhadagidffevfcdtplqdcer
    rdpkglyakarageithftgidspyqrpknpdlrltpdrsideqaqevidlles
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bzpB (B:)
    pprgktvwftglsgsgkssvamlverkllekgisayvldgdnlrhglnadlgfsmadrae
    nlrrlshvatlladcghlvlvpaisplaehralarkvhadagidffevfcdtplqdcerr
    dpkglyakarageithftgidspyqrpknpdlrltpdrsideqaqevidlles