PDB entry 4byy

View 4byy on RCSB PDB site
Description: Apo GlxR
Class: transcription
Keywords: transcription
Deposited on 2013-07-21, released 2014-07-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.21264
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulator, Crp/Fnr family
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4byya1, d4byya2
  • Chain 'B':
    Compound: transcriptional regulator, Crp/Fnr family
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4byyb1, d4byyb2
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4byyA (A:)
    megvqeilsragifqgvdptavnnliqdmetvrfprgatifdegepgdrlyiitsgkvkl
    arhapdgrenlltimgpsdmfgelsifdpgprtssavcvtevhaatmnsdmlrnwvadhp
    aiaeqllrvlarrlrrtnasladliftdvpgrvaktllqlanrfgtqeagalrvnhdltq
    eeiaqlvgasretvnkalatfahrgwirlegksvlivdtehlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4byyA (A:)
    megvqeilsragifqgvdptavnnliqdmetvrfprgatifdegepgdrlyiitsgkvkl
    arhapdgrenlltimgpsdmfgelsifdpgprtssavcvtevhaatmnsdmlrnwvadhp
    aiaeqllrvlarrlrrtnasladliftdvpgrvaktllqlanrfgtqeagalrvnhdltq
    eeiaqlvgasretvnkalatfahrgwirlegksvlivdtehlarra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4byyB (B:)
    megvqeilsragifqgvdptavnnliqdmetvrfprgatifdegepgdrlyiitsgkvkl
    arhapdgrenlltimgpsdmfgelsifdpgprtssavcvtevhaatmnsdmlrnwvadhp
    aiaeqllrvlarrlrrtnasladliftdvpgrvaktllqlanrfgtqeagalrvnhdltq
    eeiaqlvgasretvnkalatfahrgwirlegksvlivdtehlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4byyB (B:)
    gvqeilsragifqgvdptavnnliqdmetvrfprgatifdegepgdrlyiitsgkvklar
    hapdgrenlltimgpsdmfgelsifdpgprtssavcvtevhaatmnsdmlrnwvadhpai
    aeqllrvlarrlrrtnasladliftdvpgrvaktllqlanrfltqeeiaqlvgasretvn
    kalatfahrgwirlegksvliv