PDB entry 4bya

View 4bya on RCSB PDB site
Description: Calmodulin, C-terminal domain, M144H mutant
Class: metal binding protein
Keywords: calmodulin, metal binding protein
Deposited on 2013-07-18, released 2014-06-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin, c-terminal domain, m144h mutant
    Species: GALLUS GALLUS [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F2Z4K8 (2-70)
      • expression tag (0-1)
      • engineered mutation (70)
      • expression tag (71-74)
    Domains in SCOPe 2.06: d4byaa1, d4byaa2, d4byaa3
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4byaA (A:)
    slmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgd
    gqvnyeefvqhmtak