PDB entry 4bxk

View 4bxk on RCSB PDB site
Description: Crystal structure of the Angiotensin-1 converting enzyme N-domain in complex with a domain-specific inhibitor
Class: hydrolase
Keywords: hydrolase, metalloprotease, protease inhibitor
Deposited on 2013-07-12, released 2013-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.18825
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiotensin-converting enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12821 (0-End)
      • engineered mutation (8)
      • engineered mutation (24)
      • engineered mutation (81)
      • engineered mutation (116)
      • engineered mutation (288)
      • engineered mutation (544)
      • engineered mutation (575)
    Domains in SCOPe 2.07: d4bxka_
  • Chain 'B':
    Compound: angiotensin-converting enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12821 (0-End)
      • engineered mutation (8)
      • engineered mutation (24)
      • engineered mutation (81)
      • engineered mutation (116)
      • engineered mutation (288)
      • engineered mutation (544)
      • engineered mutation (575)
    Domains in SCOPe 2.07: d4bxkb_
  • Heterogens: PEG, P6G, 1IU, ZN, CL, PG4, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bxkA (A:)
    ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
    iystakvclpqktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedfta
    lsneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdr
    yinlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeef
    ftslelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvh
    hemghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtes
    dinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrn
    ethfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagakl
    rkvlragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwh
    pplpdnypegidlvtdeaeaskfveeydl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bxkA (A:)
    ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
    iystakvcltatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedftalsn
    eaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdryin
    lrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeeffts
    lelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvhhem
    ghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtesdin
    yllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrneth
    fdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagaklrkv
    lragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwhppl
    pdnypeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bxkB (B:)
    ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
    iystakvclpqktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedfta
    lsneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdr
    yinlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeef
    ftslelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvh
    hemghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtes
    dinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrn
    ethfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagakl
    rkvlragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwh
    pplpdnypegidlvtdeaeaskfveeydl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bxkB (B:)
    ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
    iystakvcltatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedftalsn
    eaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdryin
    lrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeeffts
    lelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvhhem
    ghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtesdin
    yllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrneth
    fdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagaklrkv
    lragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwhppl
    pdnypeg