PDB entry 4bwu

View 4bwu on RCSB PDB site
Description: Three-dimensional structure of the K109A mutant of Paracoccus pantotrophus pseudoazurin at pH 5.5
Class: electron transport
Keywords: electron transport
Deposited on 2013-07-04, released 2014-07-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.15185
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pseudoazurin
  Species: Paracoccus pantotrophus [TaxId:82367]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80401 (0-122)
    • engineered mutation (108)
  Domains in SCOPe 2.06: d4bwua_
• Chain 'B':
  Compound: pseudoazurin
  Species: Paracoccus pantotrophus [TaxId:82367]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80401 (0-122)
    • engineered mutation (108)
  Domains in SCOPe 2.06: d4bwub_
• Heterogens: CU, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4bwuA (A:)
  athevhmlnkgesgamvfepafvraepgdvinfvptdkshnveaikeilpegvesfkski
  nesytltvtepglygvkctphfgmgmvglvqvgdapenldaaktakmpakarermdaela
  qvn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4bwuB (B:)
  athevhmlnkgesgamvfepafvraepgdvinfvptdkshnveaikeilpegvesfkski
  nesytltvtepglygvkctphfgmgmvglvqvgdapenldaaktakmpakarermdaela
  qvn