PDB entry 4btz

View 4btz on RCSB PDB site
Description: Crystal Structure of peroxinitrite treated Major Birch Pollen Allergen Bet v 1.0101 (isoform a)
Class: immune system
Keywords: immune system, nitration
Deposited on 2013-06-19, released 2014-07-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-02, with a file datestamp of 2014-06-27.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.19009
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major pollen allergen bet v 1-a
    Species: Betula pendula [TaxId:3505]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4btza_
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4btzA (A:)
    gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
    gfpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn