PDB entry 4br6

View 4br6 on RCSB PDB site
Description: Crystal structure of Chaetomium thermophilum MnSOD
Class: oxidoreductase
Keywords: oxidoreductase, dismutation, antioxidants, thermostability, metal binding
Deposited on 2013-06-04, released 2013-12-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-12-18, with a file datestamp of 2013-12-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.123
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: CHAETOMIUM THERMOPHILUM [TaxId:209285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4br6a1, d4br6a2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: CHAETOMIUM THERMOPHILUM [TaxId:209285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4br6b1, d4br6b2
  • Chain 'C':
    Compound: superoxide dismutase
    Species: CHAETOMIUM THERMOPHILUM [TaxId:209285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4br6c1, d4br6c2
  • Chain 'D':
    Compound: superoxide dismutase
    Species: CHAETOMIUM THERMOPHILUM [TaxId:209285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4br6d1, d4br6d2
  • Heterogens: MN3, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4br6A (A:)
    katlpdlkydygalepyisarimelhhskhhqtyvnglnsaleataeaeakgdftkaasl
    apllnfhggghlnhtlfwenlapasregggepdgalkkaieadfgsfetfrkqmnaaltg
    iqgsgwawlakdkdsgnlaivtranqdpvtgqlvplmgidawehayylqyenrkaeyfea
    iwnvinwktvaqrfeka
    

    Sequence, based on observed residues (ATOM records): (download)
    >4br6A (A:)
    katlpdlkydygalepyisarimelhhskhhqtyvnglnsaleataeaeakgdftkaasl
    apllnfhggghlnhtlfwenlapasregggepdgalkkaieadfgsfetfrkqmnaaltg
    iqgsgwawlakdkdsgnlaivtranqdpvtgqlvplmgidawehayylqyenrkaeyfea
    iwnvinwktvaqrfek
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4br6B (B:)
    katlpdlkydygalepyisarimelhhskhhqtyvnglnsaleataeaeakgdftkaasl
    apllnfhggghlnhtlfwenlapasregggepdgalkkaieadfgsfetfrkqmnaaltg
    iqgsgwawlakdkdsgnlaivtranqdpvtgqlvplmgidawehayylqyenrkaeyfea
    iwnvinwktvaqrfeka
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4br6C (C:)
    katlpdlkydygalepyisarimelhhskhhqtyvnglnsaleataeaeakgdftkaasl
    apllnfhggghlnhtlfwenlapasregggepdgalkkaieadfgsfetfrkqmnaaltg
    iqgsgwawlakdkdsgnlaivtranqdpvtgqlvplmgidawehayylqyenrkaeyfea
    iwnvinwktvaqrfeka
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4br6D (D:)
    katlpdlkydygalepyisarimelhhskhhqtyvnglnsaleataeaeakgdftkaasl
    apllnfhggghlnhtlfwenlapasregggepdgalkkaieadfgsfetfrkqmnaaltg
    iqgsgwawlakdkdsgnlaivtranqdpvtgqlvplmgidawehayylqyenrkaeyfea
    iwnvinwktvaqrfeka