PDB entry 4bpl

View 4bpl on RCSB PDB site
Description: rice importin_alpha in complex with nucleoplasmin NLS
Class: transport protein
Keywords: transport protein, nuclear import, nuclear localization signal
Deposited on 2013-05-27, released 2014-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2014
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: importin subunit alpha-1a
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bpla_
  • Chain 'B':
    Compound: nucleoplasmin nls
    Species: XENOPUS [TaxId:8353]
    Database cross-references and differences (RAF-indexed):
    • PDB 4BPL (0-20)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bplA (A:)
    slpamiggvysddnnlqleattqfrkllsiersppieeviqsgvvprfvqfltredfpql
    qfeaawaltniasgtsentkvvidhgavpifvkllgsssddvreqavwalgnvagdspkc
    rdlvlangallpllaqlnehtklsmlrnatwtlsnfcrgkpqpsfeqtrpalpalarlih
    sndeevltdacwalsylsdgtndkiqavieagvcprlvelllhpspsvlipalrtvgniv
    tgddaqtqciidhqalpcllslltqnlkksikkeacwtisnitagnkdqiqavinagiig
    plvnllqtaefdikkeaawaisnatsggshdqikylvsegcikplcdllicpdirivtvc
    leglenilkvgetdktlaagdvnvfsqmideaeglekienlqshdnneiyekavkileay
    wmdeeddtmgattvaapqgatfdfgqgggaaqfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bplA (A:)
    slpamiggvysddnnlqleattqfrkllsiersppieeviqsgvvprfvqfltredfpql
    qfeaawaltniasgtsentkvvidhgavpifvkllgsssddvreqavwalgnvagdspkc
    rdlvlangallpllaqlnehtklsmlrnatwtlsnfcrgkpqpsfeqtrpalpalarlih
    sndeevltdacwalsylsdgtndkiqavieagvcprlvelllhpspsvlipalrtvgniv
    tgddaqtqciidhqalpcllslltqnlkksikkeacwtisnitagnkdqiqavinagiig
    plvnllqtaefdikkeaawaisnatsggshdqikylvsegcikplcdllicpdirivtvc
    leglenilkvgetdktlaagdvnvfsqmideaeglekienlqshdnneiyekavkileay
    wm
    

  • Chain 'B':
    No sequence available.