PDB entry 4bmt

View 4bmt on RCSB PDB site
Description: Crystal Structure of Ribonucleotide Reductase di-iron NrdF from Bacillus cereus
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2013-05-10, released 2014-03-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.21203
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonucleoside-diphosphate reductase subunit beta
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4bmta_
  • Chain 'B':
    Compound: Ribonucleoside-diphosphate reductase subunit beta
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4bmtb_
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bmtA (A:)
    mravnwnkkeddfslmfwkqniaqfwteeeiavssdkntwvqlskeeqiaykrvlggltl
    ldtkqggegmplvlvhlenlqaksvlafmgameevhaksyshifttlateeeiddifdwv
    dnhpllekkagiitsyyrrllkpevtkkelymamvasvflesylfysgffyplylagqgk
    ltasgeiinliirdesihgvfvgilaqqifaelsaeeqqevqketqellmelyeiemayt
    eeiytsiglvedvnrfvrynankglmnlglepkfeeeeinpivlnglrtdtknhdffsvk
    gngyvkatnvekladddfvfnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bmtA (A:)
    mravnwnkkeddfslmfwkqniaqfwteeeiavssdkntwvqlskeeqiaykrvlggltl
    ldtkqggegmplvlvhlenlqaksvlafmgameevhaksyshifttlateeeiddifdwv
    dnhpllekkagiitsyyrrllkpevtkkelymamvasvflesylfysgffyplylagqgk
    ltasgeiinliirdesihgvfvgilaqqifaelsaeeqqevqketqellmelyeiemayt
    eeiytsiglvedvnrfvrynankglmnlglepkfeeeeinpivlngl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bmtB (B:)
    mravnwnkkeddfslmfwkqniaqfwteeeiavssdkntwvqlskeeqiaykrvlggltl
    ldtkqggegmplvlvhlenlqaksvlafmgameevhaksyshifttlateeeiddifdwv
    dnhpllekkagiitsyyrrllkpevtkkelymamvasvflesylfysgffyplylagqgk
    ltasgeiinliirdesihgvfvgilaqqifaelsaeeqqevqketqellmelyeiemayt
    eeiytsiglvedvnrfvrynankglmnlglepkfeeeeinpivlnglrtdtknhdffsvk
    gngyvkatnvekladddfvfnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bmtB (B:)
    mravnwnkkeddfslmfwkqniaqfwteeeiavssdkntwvqlskeeqiaykrvlggltl
    ldtkqggegmplvlvhlenlqaksvlafmgameevhaksyshifttlateeeiddifdwv
    dnhpllekkagiitsyyrrllkpevtkkelymamvasvflesylfysgffyplylagqgk
    ltasgeiinliirdesihgvfvgilaqqifaelsaeeqqevqketqellmelyeiemayt
    eeiytsiglvedvnrfvrynankglmnlglepkfeeeeinpivlngl