PDB entry 4bl2

View 4bl2 on RCSB PDB site
Description: Crystal structure of PBP2a clinical mutant E150K from MRSA
Class: hydrolase
Keywords: hydrolase, penicillin binding proteins, b-lactum antibiotics
Deposited on 2013-04-30, released 2014-05-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-09-10, with a file datestamp of 2014-09-05.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: 0.2123
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penicillin binding protein 2 prime
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54113 (0-642)
      • engineered mutation (124)
    Domains in SCOPe 2.05: d4bl2a1, d4bl2a2, d4bl2a3
  • Chain 'B':
    Compound: penicillin binding protein 2 prime
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54113 (Start-642)
      • engineered mutation (124)
    Domains in SCOPe 2.05: d4bl2b1, d4bl2b2, d4bl2b3
  • Heterogens: CD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bl2A (A:)
    kdkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrki
    kkvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsihie
    nlkskrgkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmdqnw
    vqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgpinseelk
    qkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgkdiq
    ltidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynklte
    dkkepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtr
    yevvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisn
    knldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisk
    eninlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydkdnp
    nmmmainvkdvqdkgmasynakisgkvydelyengnkkydide
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bl2A (A:)
    kdkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrki
    kkvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsihie
    nlkskrgkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmdqnw
    vqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgpinseelk
    qkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgkdiq
    ltidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynklte
    dkkepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtr
    yevvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisn
    knldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisk
    eninlltdgmqqvvnkthkediyrsyanligksgtaelkgrqigwfisydkdnpnmmmai
    nvkdvqdkgmasynakisgkvydelyengnkkydide
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bl2B (B:)
    kdkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrki
    kkvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsihie
    nlkskrgkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmdqnw
    vqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgpinseelk
    qkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgkdiq
    ltidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynklte
    dkkepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtr
    yevvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisn
    knldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisk
    eninlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydkdnp
    nmmmainvkdvqdkgmasynakisgkvydelyengnkkydide
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bl2B (B:)
    dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
    kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsihien
    lkskrgkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmdqnwv
    qddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgpinseelkq
    keykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgkdiql
    tidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynklted
    kkepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtry
    evvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnk
    nldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniiske
    ninlltdgmqqvvnkthkediyrsyanligksgtaelktgrqigwfisydkdnpnmmmai
    nvkdvqdkgmasynakisgkvydelyengnkkydide