PDB entry 4bkg

View 4bkg on RCSB PDB site
Description: crystal structure of human diSUMO-2
Class: protein binding
Keywords: protein binding
Deposited on 2013-04-25, released 2013-11-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small ubiquitin-related modifier 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4bkga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4bkgA (A:)
gstenndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpine
tdtpaqlemededtidvfqqqtggrstenndhinlkvagqdgsvvqfkikrhtplsklmk
aycerqglsmrqirfrfdgqpinetdtpaqlemededtidvfqqqtgg

    Sequence, based on observed residues (ATOM records): (download) 
    >4bkgA (A:)
hinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaql
emededtidvfqq