PDB entry 4bk7

View 4bk7 on RCSB PDB site
Description: Crystal Structure of a variant of the Major Birch Pollen Allergen Bet v 1
Class: allergen
Keywords: allergen, pr-10
Deposited on 2013-04-22, released 2013-11-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: 0.13656
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: major pollen allergen bet v 1-a
  Species: Betula pendula [TaxId:3505]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15494 (0-158)
    • engineered mutation (4)
  Domains in SCOPe 2.06: d4bk7a_
• Heterogens: SO4, MPD, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4bk7A (A:)
  gvfnfetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
  gfpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
  htkgdhevkaeqvkaskemgetllravesyllahsdayn