PDB entry 4bk6

View 4bk6 on RCSB PDB site
Description: Crystal Structure of a dimeric variant of Bet v 1
Class: allergen
Keywords: allergen
Deposited on 2013-04-22, released 2013-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.184
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major pollen allergen bet v 1-a
    Species: Betula pendula [TaxId:3505]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15494 (0-158)
      • engineered mutation (4)
    Domains in SCOPe 2.07: d4bk6a_
  • Chain 'B':
    Compound: major pollen allergen bet v 1-a
    Species: Betula pendula [TaxId:3505]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15494 (0-158)
      • engineered mutation (4)
    Domains in SCOPe 2.07: d4bk6b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bk6A (A:)
    gvfncetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
    gfpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bk6B (B:)
    gvfncetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
    gfpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn