PDB entry 4bio

View 4bio on RCSB PDB site
Description: factor inhibiting hif-1 alpha in complex with 8-hydroxyquinoline-5- carboxylic acid
Class: oxidoreductase
Keywords: oxidoreductase, dioxygenase, oxygenase, DNA-binding, metal-binding, transcription, helix-loop-helix-beta, dsbh, facial triad, asparaginyl/aspartyl hydroxylase, transcription and epigenetic regulation, signaling, development, cell structure, ankyrin repeat domain, ard, beta-hydroxylation, transcription activator/inhibitor, phosphorylation, s-nitrosylation
Deposited on 2013-04-12, released 2013-04-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.2009
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypoxia-inducible factor 1-alpha inhibitor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4bioa_
  • Heterogens: FE, 8XQ, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bioA (A:)
    gshmaataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelie
    neepvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkpr
    snreemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkr
    gwgqltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcd
    rqsqvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwy
    kgaptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bioA (A:)
    sgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlv
    ypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefve
    klqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnlllig
    megnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdye
    rfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieypl
    kahqkvaimrniekmlgealgnpqevgpllntmikgryn