PDB entry 4bgw

View 4bgw on RCSB PDB site
Description: Crystal Structure of H5 (VN1194) Influenza Haemagglutinin
Class: viral protein
Keywords: viral protein, n-glycosylation, virus receptor, bird flu
Deposited on 2013-03-29, released 2013-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-10.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: INFLUENZA VIRUS [TaxId:644788]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4bgwa_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: INFLUENZA VIRUS [TaxId:644788]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4bgwb_
  • Heterogens: NAG, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bgwA (A:)
    dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
    llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
    swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
    pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
    fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
    ecpkyvksnrlvlatglrnspqretr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bgwA (A:)
    dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
    llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
    swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
    pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
    fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
    ecpkyvksnrlvlatglrnsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bgwB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bgwB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqy