PDB entry 4bgv

View 4bgv on RCSB PDB site
Description: 1.8 A resolution structure of the malate dehydrogenase from Picrophilus torridus in its apo form
Class: oxidoreductase
Keywords: hyperacidophile, oxidoreductase, tricarboxylic acid cycle
Deposited on 2013-03-28, released 2014-04-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Picrophilus torridus [TaxId:82076]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bgva1, d4bgva2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Picrophilus torridus [TaxId:82076]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bgvb1, d4bgvb2
  • Chain 'C':
    Compound: malate dehydrogenase
    Species: Picrophilus torridus [TaxId:82076]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bgvc1, d4bgvc2
  • Chain 'D':
    Compound: malate dehydrogenase
    Species: Picrophilus torridus [TaxId:82076]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bgvd1, d4bgvd2
  • Heterogens: PEG, CIT, PG6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bgvA (A:)
    arskisvigagavgatvaqtlairqtgdiyifdivdglaegkaldilegaphwgydldik
    gfctadeskyaemkgsdvivvtaglarkpgmsrddlllknigimksvgeaikkyspeski
    vvvtnpadimayaiykasgisperiiglggsldstrfrtflaqelnvsfedvnafviggh
    gddmvpfirysnvsgipiedllprekideivkrtrfgggeivnlyktgsafyapgisiav
    mvesivndrkrvipcaayitgehsktylvnnlfigvpikigkngvekiydlkfnedelea
    wkksvesvkknsaiaddyfaknq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bgvB (B:)
    arskisvigagavgatvaqtlairqtgdiyifdivdglaegkaldilegaphwgydldik
    gfctadeskyaemkgsdvivvtaglarkpgmsrddlllknigimksvgeaikkyspeski
    vvvtnpadimayaiykasgisperiiglggsldstrfrtflaqelnvsfedvnafviggh
    gddmvpfirysnvsgipiedllprekideivkrtrfgggeivnlyktgsafyapgisiav
    mvesivndrkrvipcaayitgehsktylvnnlfigvpikigkngvekiydlkfnedelea
    wkksvesvkknsaiaddyfaknq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bgvC (C:)
    arskisvigagavgatvaqtlairqtgdiyifdivdglaegkaldilegaphwgydldik
    gfctadeskyaemkgsdvivvtaglarkpgmsrddlllknigimksvgeaikkyspeski
    vvvtnpadimayaiykasgisperiiglggsldstrfrtflaqelnvsfedvnafviggh
    gddmvpfirysnvsgipiedllprekideivkrtrfgggeivnlyktgsafyapgisiav
    mvesivndrkrvipcaayitgehsktylvnnlfigvpikigkngvekiydlkfnedelea
    wkksvesvkknsaiaddyfaknq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bgvD (D:)
    arskisvigagavgatvaqtlairqtgdiyifdivdglaegkaldilegaphwgydldik
    gfctadeskyaemkgsdvivvtaglarkpgmsrddlllknigimksvgeaikkyspeski
    vvvtnpadimayaiykasgisperiiglggsldstrfrtflaqelnvsfedvnafviggh
    gddmvpfirysnvsgipiedllprekideivkrtrfgggeivnlyktgsafyapgisiav
    mvesivndrkrvipcaayitgehsktylvnnlfigvpikigkngvekiydlkfnedelea
    wkksvesvkknsaiaddyfaknq