PDB entry 4bgt

View 4bgt on RCSB PDB site
Description: 1.70 A resolution structure of the malate dehydrogenase from Chloroflexus aurantiacus
Class: oxidoreductase
Keywords: thermophile, oxidoreductase, tricarboxylic acid cycle
Deposited on 2013-03-28, released 2013-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.172
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Chloroflexus aurantiacus [TaxId:1108]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bgta3, d4bgta4
  • Chain 'D':
    Compound: malate dehydrogenase
    Species: Chloroflexus aurantiacus [TaxId:1108]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bgtd3, d4bgtd4
  • Heterogens: CD, CL, ACT, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bgtA (A:)
    mrkkisiigagfvgsttahwlaakelgdivlldfvegvpqgkaldlyeaspiegfdvrvt
    gtnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnn
    pldamtylaaevsgfpkervigqagvldaaryrtfiameagvsvedvqamlmgghgdemv
    plprfstisgipvsefiapdrlaqivertrkgggeivnllktgsayyapaaataqmveav
    lkdkkrvmpvaayltgqyglndiyfgvpvilgaggvekilelplneeemallnasakavr
    atldtlksl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bgtD (D:)
    mrkkisiigagfvgsttahwlaakelgdivlldfvegvpqgkaldlyeaspiegfdvrvt
    gtnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnn
    pldamtylaaevsgfpkervigqagvldaaryrtfiameagvsvedvqamlmgghgdemv
    plprfstisgipvsefiapdrlaqivertrkgggeivnllktgsayyapaaataqmveav
    lkdkkrvmpvaayltgqyglndiyfgvpvilgaggvekilelplneeemallnasakavr
    atldtlksl