PDB entry 4bgf

View 4bgf on RCSB PDB site
Description: The 3D-structure of arylamine-N-acetyltransferase from M. tuberculosis
Class: transferase
Keywords: transferase, drug design, cross-seeding, micro-seeding, microseed matrix screen
Deposited on 2013-03-26, released 2013-07-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arylamine N-acetyltransferase Nat
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4bgfa_
  • Chain 'B':
    Compound: Arylamine N-acetyltransferase Nat
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4bgfb_
  • Chain 'C':
    Compound: Arylamine N-acetyltransferase Nat
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4bgfc_
  • Chain 'D':
    Compound: Arylamine N-acetyltransferase Nat
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4bgfd_
  • Chain 'E':
    Compound: Arylamine N-acetyltransferase Nat
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4bgfe_
  • Chain 'F':
    Compound: Arylamine N-acetyltransferase Nat
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4bgff_
  • Chain 'G':
    Compound: Arylamine N-acetyltransferase Nat
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4bgfg_
  • Chain 'H':
    Compound: Arylamine N-acetyltransferase Nat
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4bgfh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bgfA (A:)
    maldltayfdrinyrgatdptldvlqdlvtvhsrtipfenldpllgvpvddlspqaladk
    lvlrrrggycfehnglmgyvlaelgyrvrrfaarvvwklapdaplppqthtllgvtfpgs
    ggcylvdvgfggqtptsplrletgavqptthepyrledrvdgfvlqamvrdtwqtlyeft
    tqtrpqidlkvaswyasthpaskfvtgltaavitddarwnlsgrdlavhraggtekirla
    daaavvdtlserfginvadigergaletridellarqpgadap
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bgfA (A:)
    ldltayfdrinyrgatdptldvlqdlvtvhsrtipfenldpllgvpvddlspqaladklv
    lrrrggycfehnglmgyvlaelgyrvrrfaarvvwklapdaplppqthtllgvtfpgsgg
    cylvdvgfggqtptsplrletgavqptthepyrledrvdgfvlqamvrdtwqtlyefttq
    trpqidlkvaswyasthpaskfvtgltaavitddarwnlsgrdlavhraggtekirlada
    aavvdtlserfginvadigergaletride
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bgfB (B:)
    maldltayfdrinyrgatdptldvlqdlvtvhsrtipfenldpllgvpvddlspqaladk
    lvlrrrggycfehnglmgyvlaelgyrvrrfaarvvwklapdaplppqthtllgvtfpgs
    ggcylvdvgfggqtptsplrletgavqptthepyrledrvdgfvlqamvrdtwqtlyeft
    tqtrpqidlkvaswyasthpaskfvtgltaavitddarwnlsgrdlavhraggtekirla
    daaavvdtlserfginvadigergaletridellarqpgadap
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bgfB (B:)
    ldltayfdrinyrgatdptldvlqdlvtvhsrtipfenldpllgvpvddlspqaladklv
    lrrrggycfehnglmgyvlaelgyrvrrfaarvvwklapdaplppqthtllgvtfpgsgg
    cylvdvgfggqtptsplrletgavqptthepyrledrvdgfvlqamvrdtwqtlyefttq
    trpqidlkvaswyasthpaskfvtgltaavitddarwnlsgrdlavhraggtekirlada
    aavvdtlserfginvadigergaletride
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4bgfC (C:)
    maldltayfdrinyrgatdptldvlqdlvtvhsrtipfenldpllgvpvddlspqaladk
    lvlrrrggycfehnglmgyvlaelgyrvrrfaarvvwklapdaplppqthtllgvtfpgs
    ggcylvdvgfggqtptsplrletgavqptthepyrledrvdgfvlqamvrdtwqtlyeft
    tqtrpqidlkvaswyasthpaskfvtgltaavitddarwnlsgrdlavhraggtekirla
    daaavvdtlserfginvadigergaletridellarqpgadap
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bgfC (C:)
    dltayfdrinyrgatdptldvlqdlvtvhsrtipfenldpllgvpvddlspqaladklvl
    rrrggycfehnglmgyvlaelgyrvrrfaarvvwklapdaplppqthtllgvtfpgsggc
    ylvdvgfggqtptsplrletgavqptthepyrledrvdgfvlqamvrdtwqtlyefttqt
    rpqidlkvaswyasthpaskfvtgltaavitddarwnlsgrdlavhraggtekirladaa
    avvdtlserfginvadigergaletride
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4bgfD (D:)
    maldltayfdrinyrgatdptldvlqdlvtvhsrtipfenldpllgvpvddlspqaladk
    lvlrrrggycfehnglmgyvlaelgyrvrrfaarvvwklapdaplppqthtllgvtfpgs
    ggcylvdvgfggqtptsplrletgavqptthepyrledrvdgfvlqamvrdtwqtlyeft
    tqtrpqidlkvaswyasthpaskfvtgltaavitddarwnlsgrdlavhraggtekirla
    daaavvdtlserfginvadigergaletridellarqpgadap
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bgfD (D:)
    ldltayfdrinyrgatdptldvlqdlvtvhsrtipfenldpllgvpvddlspqaladklv
    lrrrggycfehnglmgyvlaelgyrvrrfaarvvwklapdaplppqthtllgvtfpgsgg
    cylvdvgfggqtptsplrletgavqptthepyrledrvdgfvlqamvrdtwqtlyefttq
    trpqidlkvaswyasthpaskfvtgltaavitddarwnlsgrdlavhraggtekirlada
    aavvdtlserfginvadigergaletride
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4bgfE (E:)
    maldltayfdrinyrgatdptldvlqdlvtvhsrtipfenldpllgvpvddlspqaladk
    lvlrrrggycfehnglmgyvlaelgyrvrrfaarvvwklapdaplppqthtllgvtfpgs
    ggcylvdvgfggqtptsplrletgavqptthepyrledrvdgfvlqamvrdtwqtlyeft
    tqtrpqidlkvaswyasthpaskfvtgltaavitddarwnlsgrdlavhraggtekirla
    daaavvdtlserfginvadigergaletridellarqpgadap
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bgfE (E:)
    ldltayfdrinyrgatdptldvlqdlvtvhsrtipfenldpllgvpvddlspqaladklv
    lrrrggycfehnglmgyvlaelgyrvrrfaarvvwklapdaplppqthtllgvtfpgsgg
    cylvdvgfggqtptsplrletgavqptthepyrledrvdgfvlqamvrdtwqtlyefttq
    trpqidlkvaswyasthpaskfvtgltaavitddarwnlsgrdlavhraggtekirlada
    aavvdtlserfginvadigergaletride
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4bgfF (F:)
    maldltayfdrinyrgatdptldvlqdlvtvhsrtipfenldpllgvpvddlspqaladk
    lvlrrrggycfehnglmgyvlaelgyrvrrfaarvvwklapdaplppqthtllgvtfpgs
    ggcylvdvgfggqtptsplrletgavqptthepyrledrvdgfvlqamvrdtwqtlyeft
    tqtrpqidlkvaswyasthpaskfvtgltaavitddarwnlsgrdlavhraggtekirla
    daaavvdtlserfginvadigergaletridellarqpgadap
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bgfF (F:)
    ldltayfdrinyrgatdptldvlqdlvtvhsrtipfenldpllgvpvddlspqaladklv
    lrrrggycfehnglmgyvlaelgyrvrrfaarvvwklapdaplppqthtllgvtfpgsgg
    cylvdvgfggqtptsplrletgavqptthepyrledrvgfvlqamvrdtwqtlyefttqt
    rpqidlkvaswyasthpaskfvtgltaavitddarwnlsgrdlavhraggtekirladaa
    avvdtlserfginvadigergaletridell
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4bgfG (G:)
    maldltayfdrinyrgatdptldvlqdlvtvhsrtipfenldpllgvpvddlspqaladk
    lvlrrrggycfehnglmgyvlaelgyrvrrfaarvvwklapdaplppqthtllgvtfpgs
    ggcylvdvgfggqtptsplrletgavqptthepyrledrvdgfvlqamvrdtwqtlyeft
    tqtrpqidlkvaswyasthpaskfvtgltaavitddarwnlsgrdlavhraggtekirla
    daaavvdtlserfginvadigergaletridellarqpgadap
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bgfG (G:)
    ldltayfdrinyrgatdptldvlqdlvtvhsrtipfenldpllgvpvddlspqaladklv
    lrrrggycfehnglmgyvlaelgyrvrrfaarvvwklapdaplppqthtllgvtfpgsgg
    cylvdvgfggqtptsplrletgavqptthepyrledrvdgfvlqamvrdtwqtlyefttq
    trpqidlkvaswyasthpaskfvtgltaavitddarwnlsgrdlavhraggtekirlada
    aavvdtlserfginvadigergaletride
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4bgfH (H:)
    maldltayfdrinyrgatdptldvlqdlvtvhsrtipfenldpllgvpvddlspqaladk
    lvlrrrggycfehnglmgyvlaelgyrvrrfaarvvwklapdaplppqthtllgvtfpgs
    ggcylvdvgfggqtptsplrletgavqptthepyrledrvdgfvlqamvrdtwqtlyeft
    tqtrpqidlkvaswyasthpaskfvtgltaavitddarwnlsgrdlavhraggtekirla
    daaavvdtlserfginvadigergaletridellarqpgadap
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bgfH (H:)
    ldltayfdrinyrgatdptldvlqdlvtvhsrtipfenldpllgvpvddlspqaladklv
    lrrrggycfehnglmgyvlaelgyrvrrfaarvvwklapdaplppqthtllgvtfpgsgg
    cylvdvgfggqtptsplrletgavqptthepyrledrvdgfvlqamvrdtwqtlyefttq
    trpqidlkvaswyasthpaskfvtgltaavitddarwnlsgrdlavhraggtekirlada
    aavvdtlserfginvadigergaletride