PDB entry 4bdp

View 4bdp on RCSB PDB site
Description: crystal structure of bacillus DNA polymerase I fragment complexed to 11 base pairs of duplex DNA after addition of two datp residues
Class: transferase/DNA
Keywords: bacillus stearothermophilus DNA polymerase, bf thermophilus polymerase, complex (nucleotidyltransferase/DNA)
Deposited on 1997-11-17, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.248
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (DNA polymerase I)
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52026 (0-579)
      • conflict (1)
      • conflict (114)
      • conflict (159)
      • conflict (208)
      • conflict (215)
      • conflict (253)
      • conflict (526)
    Domains in SCOPe 2.07: d4bdpa1, d4bdpa2
  • Chain 'P':
    Compound: DNA (5'-d(*gp*cp*ap*tp*cp*ap*tp*gp*cp*ap*a)-3')
  • Chain 'T':
    Compound: DNA (5'-d(*tp*ap*tp*tp*gp*cp*ap*tp*gp*ap*tp*gp*c)-3')
  • Heterogens: SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bdpA (A:)
    aamaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
    fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvraaakm
    kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrneqdrllve
    leqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefninspkqlgv
    ilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyiegllkvvr
    pdtkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwlifaadysq
    ielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakavnfgivygi
    sdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllhrrrylpdi
    tsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqvhdelilea
    pkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.