PDB entry 4bd9

View 4bd9 on RCSB PDB site
Description: Structure of the complex between SmCI and human carboxypeptidase A4
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase-hydrolase inhibitor complex, serine protease inhibitor
Deposited on 2012-10-05, released 2013-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-17, with a file datestamp of 2013-07-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2247
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase a4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: carboxypeptidase inhibitor smci
    Species: SABELLASTARTE MAGNIFICA [TaxId:389514]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84875 (0-164)
      • engineered mutation (22)
    Domains in SCOPe 2.07: d4bd9b1, d4bd9b2, d4bd9b3
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bd9B (B:)
    isvcdlpadrgqctayipqwffakttedcekfvyggcqgnanrfetkddciancgcnlps
    kvgpcrvsarmwfhnpetekcevfiyggchgnanrfatetecqevcdryqkpgfcyqpse
    tgpckgsfpryyydyedgeckefiyggcegnannfetkescenac