PDB entry 4bd1

View 4bd1 on RCSB PDB site
Description: Neutron structure of a perdeuterated Toho-1 R274N R276N double mutant Beta-lactamase in complex with a fully deuterated boronic acid (BZB)
Class: hydrolase
Keywords: hydrolase, perdeuterated neutron structure, extended-spectrum beta lactamases, ctx- m-type esbls
Deposited on 2012-10-04, released 2013-01-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: NEUT
Resolution: 2 Å
R-factor: 0.2214
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Toho-1 beta-lactamase
  Species: ESCHERICHIA COLI BL21 [TaxId:511693]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q47066 (0-260)
    • engineered mutation (244)
    • engineered mutation (246)
  Domains in SCOPe 2.06: d4bd1a_
• Heterogens: BZB, DOD

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4bd1A (A:)
  nsvqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesd
  khllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdk
  vtafarslgdetfrldrteptlntaipgdprdtttplamaqtlknltlgkalaetqraql
  vtwlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpe
  qkaenrndilaaaakivthgf