PDB entry 4bcq

View 4bcq on RCSB PDB site
Description: Structure of CDK2 in complex with cyclin A and a 2-amino-4-heteroaryl- pyrimidine inhibitor
Class: transferase/cell cycle
Keywords: transferase-cell cycle complex, cdk-cyclin complex, cyclin a, cyclin- dependent kinase 2, structure-based drug design
Deposited on 2012-10-02, released 2013-01-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.2171
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.03: d4bcqa_
  • Chain 'B':
    Compound: Cyclin-A2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30274 (Start-260)
      • expression tag (261)
      • conflict (132)
      • conflict (140)
      • conflict (206-207)
      • conflict (216)
      • conflict (220)
      • conflict (229)
    Domains in SCOPe 2.03: d4bcqb1, d4bcqb2
  • Chain 'C':
    Compound: cyclin-dependent kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.03: d4bcqc_
  • Chain 'D':
    Compound: Cyclin-A2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30274
      • conflict (132)
      • conflict (140)
      • conflict (206-207)
      • conflict (215)
      • conflict (219)
      • conflict (229)
    Domains in SCOPe 2.03: d4bcqd1, d4bcqd2
  • Heterogens: TJF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bcqA (A:)
    pgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllke
    lnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglaf
    chshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgc
    kyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdyk
    psfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bcqA (A:)
    pgsmenfqkvekigvvykarnkltgevvalkkirldtetegvpstaireisllkelnhpn
    ivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchshr
    vlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyyst
    avdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpk
    warqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvph
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bcqB (B:)
    svnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqne
    tlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkq
    vlrmehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylky
    lpsviaaaafhlalytvtgqswpeslirktgytletskpcmldlhqtylkapqhaqqsir
    ekyknskyhgvsllnppetlnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bcqB (B:)
    pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
    vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
    hlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsvi
    aaaafhlalytvtgqswpeslirktgytletskpcmldlhqtylkapqhaqqsirekykn
    skyhgvsllnppetlnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4bcqC (C:)
    pgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllke
    lnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglaf
    chshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgc
    kyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdyk
    psfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bcqC (C:)
    smenfqkvekigeygvvykarnkltgevvalkkirldtetegvpstaireisllkelnhp
    nivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchsh
    rvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyys
    tavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfp
    kwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4bcqD (D:)
    svnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqne
    tlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkq
    vlrmehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylky
    lpsviaaaafhlalytvtgqswpeslirktgytleslkpmlldlhqtylkapqhaqqsir
    ekyknskyhgvsllnppetlnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bcqD (D:)
    pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
    vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
    hlvlkvltfdlaaptvnqfltqyflhqanckveslamflgelslidadpylkylpsviaa
    aafhlalytvtgqswpeslirktgytleslkpmlldlhqtylkapqhaqqsirekyknsk
    yhgvsllnppetln