PDB entry 4bbp

View 4bbp on RCSB PDB site
Description: X-ray structure of zinc bound ZnuA in complex with RDS51
Class: transport protein
Keywords: transport protein, zinc transport inhibition
Deposited on 2012-09-27, released 2013-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-20, with a file datestamp of 2016-04-15.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: zinc abc transporter, periplasmic zinc-binding protein
    Species: SALMONELLA ENTERICA [TaxId:28901]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bbpa_
  • Heterogens: YU7, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bbpA (A:)
    aavvaslkplgfiasaiadgvtdtqvllpdgasehdyslrpsdvkrlqgadlvvwvgpem
    eafmeksvrnipdnkqvtiaqladvkpllmkgadddedehahtgadeekgdvhhhhgeyn
    mhlwlspeiaratavaiheklvelmpqsrakldanlkdfeaqlaatdkqvgnelaplkgk
    gyfvfhdaygyyekhygltplghftvnpeiqpgaqrlheirtqlveqkatcvfaepqfrp
    avveavargtsvrmgtldplgtniklgktsysaflsqlanqyasclkgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bbpA (A:)
    avvaslkplgfiasaiadgvtdtqvllpdgasehdyslrpsdvkrlqgadlvvwvgpeme
    afmeksvrnipdnkqvtiaqladvkpllmkhhhgeynmhlwlspeiaratavaiheklve
    lmpqsrakldanlkdfeaqlaatdkqvgnelaplkgkgyfvfhdaygyyekhygltplgh
    ftvnpeiqpgaqrlheirtqlveqkatcvfaepqfrpavveavargtsvrmgtldplgtn
    iklgktsysaflsqlanqyasclkgd