PDB entry 4bb0

View 4bb0 on RCSB PDB site
Description: Structure of a putative epoxide hydrolase Q244E mutant from Pseudomonas aeruginosa, with bound MFA.
Class: hydrolase
Keywords: hydrolase
Deposited on 2012-09-17, released 2013-10-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.15418
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable epoxide hydrolase
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I229 (Start-300)
      • engineered mutation (244)
    Domains in SCOPe 2.06: d4bb0a_
  • Heterogens: SO4, FAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bb0A (A:)
    smntdpllpgfdyltlhtsaarlrvavkgsgppllllhgypqthlawhriaprlaedysv
    vladlrgygesraldeegadyskaalardqletmgqlgferfavighdrgarvgyrlald
    hpqavaafvsltvvpildnwaavnkvfalnayhwfllaqpydlperligadpehfldytl
    rrmaqgrdiyhpqalesyrrafrdpavrhamcedyraavgvdadadqadrdagrrlqcpv
    qvlweerpyaagqhpleiwktwagqvegaaigashmlpedapdavlehllgflashreal
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bb0A (A:)
    dpllpgfdyltlhtsaarlrvavkgsgppllllhgypqthlawhriaprlaedysvvlad
    lrgygesraldgadyskaalardqletmgqlgferfavighdrgarvgyrlaldhpqava
    afvsltvvpildnwaavnkvfalnayhwfllaqpydlperligadpehfldytlrrmaqg
    rdiyhpqalesyrrafrdpavrhamcedyraavgvdadadqadrdagrrlqcpvqvlwee
    rpyaagqhpleiwktwagqvegaaigashmlpedapdavlehllgflashrealr