PDB entry 4ba8

View 4ba8 on RCSB PDB site
Description: High resolution NMR structure of the C mu3 domain from IgM
Class: immune system
Keywords: immune system, immunoglobulin constant region
Deposited on 2012-09-12, released 2013-06-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ig mu chain c region secreted form
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01872 (2-101)
      • expression tag (0-1)
      • conflict (54)
      • engineered mutation (72)
    Domains in SCOPe 2.06: d4ba8a1, d4ba8a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ba8A (A:)
    mgdiltftippsfadiflsksanltclvsnlatyetlniswasqsgepletkikvmeshp
    ngtfsakgvasvsvedwnnrkefvctvthrdlpspqkkfisk