PDB entry 4b9k

View 4b9k on RCSB PDB site
Description: pVHL-ELOB-ELOC complex_(2S,4R)-1-(3-amino-2-methylbenzoyl)-4-hydroxy-N-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide bound
Class: ligase
Keywords: ligase, inhibitor
Deposited on 2012-09-05, released 2012-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.1903
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b9ka_
  • Chain 'B':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15369 (1-96)
      • expression tag (0)
    Domains in SCOPe 2.07: d4b9kb1, d4b9kb2
  • Chain 'C':
    Compound: von hippel-lindau disease tumor suppressor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b9kc_
  • Chain 'D':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b9kd_
  • Chain 'E':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b9ke_
  • Chain 'F':
    Compound: von hippel-lindau disease tumor suppressor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b9kf_
  • Chain 'G':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b9kg_
  • Chain 'H':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b9kh_
  • Chain 'I':
    Compound: von hippel-lindau disease tumor suppressor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b9ki_
  • Chain 'J':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b9kj_
  • Chain 'K':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15369 (1-96)
      • expression tag (0)
    Domains in SCOPe 2.07: d4b9kk1, d4b9kk2
  • Chain 'L':
    Compound: von hippel-lindau disease tumor suppressor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b9kl_
  • Heterogens: TG0, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b9kA (A:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b9kA (A:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafradtfealciepfssppelpdvmk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4b9kB (B:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b9kB (B:)
    mmyvklissdghefivkrehaltsgtikamlstnevnfreipshvlskvcmyftykvryt
    nssteipefpiapeialellmaanfldc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4b9kC (C:)
    smsenlyfqgsmeagrprpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlp
    pgtgrrihsyrghlwlfrdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerc
    lqvvrslvkpenyrrldivrslyedledhpnvqkdlerltqeriahqrmgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b9kC (C:)
    vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
    agthdgllvnqtelfvpslnqpifanitlpvytlkerclqvvrslvkpenyrrldivrsl
    yedledhpnvqkdlerlt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4b9kD (D:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b9kD (D:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafrdtfealciepfssppelpdvm
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4b9kE (E:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b9kE (E:)
    myvklissdghefivkrehaltsgtikamlstnevnfreipshvlskvcmyftykvrytn
    ssteipefpiapeialellmaanfldc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4b9kF (F:)
    smsenlyfqgsmeagrprpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlp
    pgtgrrihsyrghlwlfrdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerc
    lqvvrslvkpenyrrldivrslyedledhpnvqkdlerltqeriahqrmgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b9kF (F:)
    vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
    agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
    rslyedledhpnvqkdlerltqe
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4b9kG (G:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b9kG (G:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvm
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4b9kH (H:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b9kH (H:)
    myvklissdghefivkrehaltsgtikamlsgetnevnfreipshvlskvcmyftykvry
    tnssteipefpiapeialellmaanfldc
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4b9kI (I:)
    smsenlyfqgsmeagrprpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlp
    pgtgrrihsyrghlwlfrdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerc
    lqvvrslvkpenyrrldivrslyedledhpnvqkdlerltqeriahqrmgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b9kI (I:)
    vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
    agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
    rslyedledhpnvqkdlerltqeriah
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4b9kJ (J:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b9kJ (J:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvm
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4b9kK (K:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b9kK (K:)
    mmyvklissdghefivkrehaltsgtikamlsgpetnevnfreipshvlskvcmyftykv
    rytnssteipefpiapeialellmaanfldc
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4b9kL (L:)
    smsenlyfqgsmeagrprpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlp
    pgtgrrihsyrghlwlfrdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerc
    lqvvrslvkpenyrrldivrslyedledhpnvqkdlerltqeriahqrmgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b9kL (L:)
    vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
    agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
    rslyedledhpnvqkdlerltqeria