PDB entry 4b9e

View 4b9e on RCSB PDB site
Description: Structure of a putative epoxide hydrolase from Pseudomonas aeruginosa, with bound MFA.
Class: hydrolase
Keywords: hydrolase, monofluoroacetate, defluorinase
Deposited on 2012-09-04, released 2013-02-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.11165
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable epoxide hydrolase
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4b9ea_
  • Heterogens: FAH, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b9eA (A:)
    smntdpllpgfdyltlhtsaarlrvavkgsgppllllhgypqthlawhriaprlaedysv
    vladlrgygesraldeegadyskaalardqletmgqlgferfavighdrgarvgyrlald
    hpqavaafvsltvvpildnwaavnkvfalnayhwfllaqpydlperligadpehfldytl
    rrmaqgrdiyhpqalesyrrafrdpavrhamcedyraavgvdadadqadrdagrrlqcpv
    qvlwqerpyaagqhpleiwktwagqvegaaigashmlpedapdavlehllgflashreal
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b9eA (A:)
    dpllpgfdyltlhtsaarlrvavkgsgppllllhgypqthlawhriaprlaedysvvlad
    lrgygesraldeegadyskaalardqletmgqlgferfavighdrgarvgyrlaldhpqa
    vaafvsltvvpildnwaavnkvfalnayhwfllaqpydlperligadpehfldytlrrma
    qgrdiyhpqalesyrrafrdpavrhamcedyraavgvdadadqadrdagrrlqcpvqvlw
    qerpyaagqhpleiwktwagqvegaaigashmlpedapdavlehllgflashrealr