PDB entry 4b8o

View 4b8o on RCSB PDB site
Description: rImp_alpha_SV40TAgNLS
Class: transport protein
Keywords: transport protein, nuclear localization signal
Deposited on 2012-08-28, released 2013-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-20, with a file datestamp of 2013-02-15.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.1688
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: importin subunit alpha-1a
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b8oa_
  • Chain 'B':
    Compound: sv40tagnls
    Species: Simian virus 40 [TaxId:10633]
    Database cross-references and differences (RAF-indexed):
    • PDB 4B8O (0-10)
  • Chain 'C':
    Compound: sv40tagnls
    Species: Simian virus 40 [TaxId:10633]
    Database cross-references and differences (RAF-indexed):
    • PDB 4B8O
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b8oA (A:)
    gsgmketaaakferqhmdspdlgtddddkamadigsslpamiggvysddnnlqleattqf
    rkllsiersppieeviqsgvvprfvqfltredfpqlqfeaawaltniasgtsentkvvid
    hgavpifvkllgsssddvreqavwalgnvagdspkcrdlvlangallpllaqlnehtkls
    mlrnatwtlsnfcrgkpqpsfeqtrpalpalarlihsndeevltdacwalsylsdgtndk
    iqavieagvcprlvelllhpspsvlipalrtvgnivtgddaqtqciidhqalpcllsllt
    qnlkksikkeacwtisnitagnkdqiqavinagiigplvnllqtaefdikkeaawaisna
    tsggshdqikylvsegcikplcdllicpdirivtvcleglenilkvgetdktlaagdvnv
    fsqmideaeglekienlqshdnneiyekavkileaywmdeeddtmgattvaapqgatfdf
    gqgggaaqfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b8oA (A:)
    slpamiggvysddnnlqleattqfrkllsiersppieeviqsgvvprfvqfltredfpql
    qfeaawaltniasgtsentkvvidhgavpifvkllgsssddvreqavwalgnvagdspkc
    rdlvlangallpllaqlnehtklsmlrnatwtlsnfcrgkpqpsfeqtrpalpalarlih
    sndeevltdacwalsylsdgtndkiqavieagvcprlvelllhpspsvlipalrtvgniv
    tgddaqtqciidhqalpcllslltqnlkksikkeacwtisnitagnkdqiqavinagiig
    plvnllqtaefdikkeaawaisnatsggshdqikylvsegcikplcdllicpdirivtvc
    leglenilkvgetdktlaagdvnvfsqmideaeglekienlqshdnneiyekavkileay
    wm
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.