PDB entry 4b8j

View 4b8j on RCSB PDB site
Description: rImp_alpha1a
Class: transport protein
Keywords: transport protein, nuclear localization signal
Deposited on 2012-08-28, released 2013-01-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-02-20, with a file datestamp of 2013-02-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.1496
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: importin subunit alpha-1a
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4b8ja_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b8jA (A:)
    gsmslrpservevrrnrykvavdaeegrrrrednmveirksrreesllkkrreglqaqap
    vpasaatgvdkkleslpamiggvysddnnlqleattqfrkllsiersppieeviqsgvvp
    rfvqfltredfpqlqfeaawaltniasgtsentkvvidhgavpifvkllgsssddvreqa
    vwalgnvagdspkcrdlvlangallpllaqlnehtklsmlrnatwtlsnfcrgkpqpsfe
    qtrpalpalarlihsndeevltdacwalsylsdgtndkiqavieagvcprlvelllhpsp
    svlipalrtvgnivtgddaqtqciidhqalpcllslltqnlkksikkeacwtisnitagn
    kdqiqavinagiigplvnllqtaefdikkeaawaisnatsggshdqikylvsegcikplc
    dllicpdirivtvcleglenilkvgetdktlaagdvnvfsqmideaeglekienlqshdn
    neiyekavkileaywmdeeddtmgattvaapqgatfdfgqgggaaqfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b8jA (A:)
    grrrrkkrrslpamiggvysddnnlqleattqfrkllsiersppieeviqsgvvprfvqf
    ltredfpqlqfeaawaltniasgtsentkvvidhgavpifvkllgsssddvreqavwalg
    nvagdspkcrdlvlangallpllaqlnehtklsmlrnatwtlsnfcrgkpqpsfeqtrpa
    lpalarlihsndeevltdacwalsylsdgtndkiqavieagvcprlvelllhpspsvlip
    alrtvgnivtgddaqtqciidhqalpcllslltqnlkksikkeacwtisnitagnkdqiq
    avinagiigplvnllqtaefdikkeaawaisnatsggshdqikylvsegcikplcdllic
    pdirivtvcleglenilkvgetdktlaagdvnvfsqmideaeglekienlqshdnneiye
    kavkileaywm