PDB entry 4b8a

View 4b8a on RCSB PDB site
Description: Structure of yeast NOT1 MIF4G domain co-crystallized with CAF1
Class: transcription/hydrolase
Keywords: transcription-hydrolase complex
Deposited on 2012-08-26, released 2012-11-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-04-20, with a file datestamp of 2016-04-15.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: general negative regulator of transcription subunit 1
    Species: SACCHAROMYCES CEREVISIAE S288C [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: poly(a) ribonuclease pop2
    Species: SACCHAROMYCES CEREVISIAE S288C [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39008 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.08: d4b8ab1, d4b8ab2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4b8aB (B:)
    rsmflpppnylfvrdvwksnlysefavirqlvsqynhvsistefvgtlarpigtfrskvd
    yhyqtmranvdflnpiqlglslsdangnkpdngpstwqfnfefdpkkeimsteslellrk
    sginfekhenlgidvfefsqllmdsglmmddsvtwityhaaydlgflinilmndsmpnnk
    edfewwvhqympnfydlnlvykiiqefknpqlqqssqqqqqqqyslttladelglprfsi
    ftttggqsllmllsfcqlsklsmhkfpngtdfakyqgviygidgdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b8aB (B:)
    mflpppnylfvrdvwksnlysefavirqlvsqynhvsistefvgtlarkvdyhyqtmran
    vdflnpiqlglslsdangnkpdngpstwqfnfefdpkkeimsteslginfekhenlgidv
    fefsqllmdsglmmddsvtwityhaaydlgflinilmndsmpnnkedfewwvhqympnfy
    dlnlvykiiqefknqyslttladelglprfsiftttggqsllmllsfcqlsklsmhkfpn
    gtdfakyqgviy