PDB entry 4b7u

View 4b7u on RCSB PDB site
Description: plasmodium falciparum l-lactate dehydrogenase complexed with bicine
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2012-08-22, released 2012-10-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.17689
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71T02 (Start-315)
      • expression tag (316)
    Domains in SCOPe 2.06: d4b7ua1, d4b7ua2, d4b7ua3
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71T02 (Start-315)
      • expression tag (316)
    Domains in SCOPe 2.06: d4b7ub1, d4b7ub2, d4b7ub3
  • Chain 'C':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71T02 (Start-315)
      • expression tag (316)
    Domains in SCOPe 2.06: d4b7uc1, d4b7uc2, d4b7uc3
  • Chain 'D':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71T02 (Start-315)
      • expression tag (316-317)
    Domains in SCOPe 2.06: d4b7ud1, d4b7ud2, d4b7ud3
  • Heterogens: CA, BCN, MPD, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b7uA (A:)
    mapkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnck
    vsgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpna
    fiivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivg
    ahgnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapa
    aaiiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseeka
    kfdeaiaetkrmkalahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b7uA (A:)
    apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
    sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
    iivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivga
    hgnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapaa
    aiiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseekak
    fdeaiaetkrmkalah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4b7uB (B:)
    mapkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnck
    vsgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpna
    fiivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivg
    ahgnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapa
    aaiiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseeka
    kfdeaiaetkrmkalahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b7uB (B:)
    apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
    sgsntyddlagadvvivtagftrddllplnnkimieigghikkncpnafiivvtnpvdvm
    vqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkry
    itvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapaaaiiemaesylk
    dlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseekakfdeaiaetkrm
    kalah
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4b7uC (C:)
    mapkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnck
    vsgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpna
    fiivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivg
    ahgnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapa
    aaiiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseeka
    kfdeaiaetkrmkalahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b7uC (C:)
    apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
    sgsntyddlagadvvivtagftrddllplnnkimieigghikkncpnafiivvtnpvdvm
    vqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkry
    itvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapaaaiiemaesylk
    dlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseekakfdeaiaetkrm
    kalah
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4b7uD (D:)
    mapkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnck
    vsgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpna
    fiivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivg
    ahgnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapa
    aaiiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseeka
    kfdeaiaetkrmkalahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b7uD (D:)
    apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
    sgsntyddlagadvvivtagftrddllplnnkimieigghikkncpnafiivvtnpvdvm
    vqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkry
    itvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapaaaiiemaesylk
    dlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseekakfdeaiaetkrm
    kalahh