PDB entry 4b7i

View 4b7i on RCSB PDB site
Description: Crystal Structure of Human IgG Fc Bearing Hybrid-type Glycans
Class: immune system
Keywords: immune system, igg, antibody, swainsonine, hybrid
Deposited on 2012-08-20, released 2012-10-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-11-07, with a file datestamp of 2012-11-02.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: 0.21784
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857 (0-End)
      • cloning artifact (156)
    Domains in SCOPe 2.04: d4b7ia1, d4b7ia2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • cloning artifact (156)
    Domains in SCOPe 2.04: d4b7ib1, d4b7ib2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b7iA (A:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykatppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslslspgtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b7iA (A:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykatppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4b7iB (B:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykatppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslslspgtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b7iB (B:)
    psvflfppkpkdtlmisrtpevtcvvvdvkfnwyvdgvevhnaktkprestyrvvsvltv
    lhqdwlngkeykckpapiektiskakgqprepqvytlppsrdeltknqvsltclvkgfyp
    sdiavewesngqpennykatppvldsdgsfflyskltvdksrwqqgnvfscsvmhealhn
    hytqkslsls