PDB entry 4b5e

View 4b5e on RCSB PDB site
Description: Crystal Structure of an amyloid-beta binding single chain antibody PS2-8
Class: immune system
Keywords: immune system, vhh, alzheimer's disease
Deposited on 2012-08-03, released 2013-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ps2-8
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4B5E (Start-126)
    Domains in SCOPe 2.07: d4b5ea_
  • Chain 'B':
    Compound: ps2-8
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4B5E (0-126)
    Domains in SCOPe 2.07: d4b5eb_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b5eA (A:)
    evqlvesggglvqaggslrlscaasgrsfsrdamgwfrqapgkerdvvaainlnggrtys
    adsvkgrftisrdndkntvylqmsnlkpedtavyycaaregdvglvsykrssnypywgqg
    tqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b5eA (A:)
    vqlvesggglvqaggslrlscaasgrsfsrdamgwfrqapgkerdvvaainlnggrtysa
    dsvkgrftisrdndkntvylqmsnlkpedtavyycaaregdvglvsykrssnypywgqgt
    qvtvss
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4b5eB (B:)
    evqlvesggglvqaggslrlscaasgrsfsrdamgwfrqapgkerdvvaainlnggrtys
    adsvkgrftisrdndkntvylqmsnlkpedtavyycaaregdvglvsykrssnypywgqg
    tqvtvss