PDB entry 4b3k

View 4b3k on RCSB PDB site
Description: Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes
Class: hydrolase
Keywords: hydrolase, glycosidase, carbohydrate-active enzyme
Deposited on 2012-07-24, released 2013-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.22594
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: STREPTOCOCCUS PYOGENES [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b3ka_
  • Chain 'B':
    Compound: Beta-glucosidase
    Species: STREPTOCOCCUS PYOGENES [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b3kb_
  • Chain 'C':
    Compound: Beta-glucosidase
    Species: STREPTOCOCCUS PYOGENES [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b3kc_
  • Chain 'D':
    Compound: Beta-glucosidase
    Species: STREPTOCOCCUS PYOGENES [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b3kd_
  • Chain 'E':
    Compound: Beta-glucosidase
    Species: STREPTOCOCCUS PYOGENES [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b3ke_
  • Chain 'F':
    Compound: Beta-glucosidase
    Species: STREPTOCOCCUS PYOGENES [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b3kf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b3kA (A:)
    lafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqiesd
    ltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhfd
    lpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhyp
    aivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaaa
    hfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyhp
    krvkapdaipvispswspewyydpylmpgrrmnvdkgweiypeavydiaikmrdhydnip
    wflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpidg
    wswlnayknryglvennihtqvrrpkasaywfkkvathnrlislevmeefggsashlsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b3kA (A:)
    lafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqiesd
    ltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhfd
    lpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhyp
    aivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaaa
    hfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyhp
    krvkapdaipvispswspewyydpylmpgrrmnvdkgweiypeavydiaikmrdhydnip
    wflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpidg
    wswlnayknryglvennihtqvrrpkasaywfkkvathnrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4b3kB (B:)
    lafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqiesd
    ltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhfd
    lpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhyp
    aivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaaa
    hfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyhp
    krvkapdaipvispswspewyydpylmpgrrmnvdkgweiypeavydiaikmrdhydnip
    wflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpidg
    wswlnayknryglvennihtqvrrpkasaywfkkvathnrlislevmeefggsashlsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b3kB (B:)
    lafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqiesd
    ltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhfd
    lpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhyp
    aivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaaa
    hfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyhp
    krvkapdaipvispswspewyydpylmpgrrmnvdkgweiypeavydiaikmrdhydnip
    wflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpidg
    wswlnayknryglvennihtqvrrpkasaywfkkvathnrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4b3kC (C:)
    lafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqiesd
    ltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhfd
    lpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhyp
    aivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaaa
    hfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyhp
    krvkapdaipvispswspewyydpylmpgrrmnvdkgweiypeavydiaikmrdhydnip
    wflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpidg
    wswlnayknryglvennihtqvrrpkasaywfkkvathnrlislevmeefggsashlsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b3kC (C:)
    lafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqiesd
    ltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhfd
    lpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhyp
    aivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaaa
    hfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyhp
    krvkapdaipvispswspewyydpylmpgrrmnvdkgweiypeavydiaikmrdhydnip
    wflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpidg
    wswlnayknryglvennihtqvrrpkasaywfkkvathnrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4b3kD (D:)
    lafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqiesd
    ltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhfd
    lpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhyp
    aivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaaa
    hfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyhp
    krvkapdaipvispswspewyydpylmpgrrmnvdkgweiypeavydiaikmrdhydnip
    wflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpidg
    wswlnayknryglvennihtqvrrpkasaywfkkvathnrlislevmeefggsashlsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b3kD (D:)
    lafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqiesd
    ltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhfd
    lpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhyp
    aivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaaa
    hfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyhp
    krvkapdaipvispswspewyydpylmpgrrmnvdkgweiypeavydiaikmrdhydnip
    wflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpidg
    wswlnayknryglvennihtqvrrpkasaywfkkvathnrl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4b3kE (E:)
    lafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqiesd
    ltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhfd
    lpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhyp
    aivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaaa
    hfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyhp
    krvkapdaipvispswspewyydpylmpgrrmnvdkgweiypeavydiaikmrdhydnip
    wflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpidg
    wswlnayknryglvennihtqvrrpkasaywfkkvathnrlislevmeefggsashlsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b3kE (E:)
    lafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqiesd
    ltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhfd
    lpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhyp
    aivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaaa
    hfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyhp
    krvkapdaipvispswspewyydpylmpgrrmnvdkgweiypeavydiaikmrdhydnip
    wflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpidg
    wswlnayknryglvennihtqvrrpkasaywfkkvathnrl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4b3kF (F:)
    lafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqiesd
    ltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhfd
    lpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhyp
    aivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaaa
    hfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyhp
    krvkapdaipvispswspewyydpylmpgrrmnvdkgweiypeavydiaikmrdhydnip
    wflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpidg
    wswlnayknryglvennihtqvrrpkasaywfkkvathnrlislevmeefggsashlsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b3kF (F:)
    lafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqiesd
    ltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhfd
    lpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhyp
    aivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaaa
    hfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyhp
    krvkapdaipvispswspewyydpylmpgrrmnvdkgweiypeavydiaikmrdhydnip
    wflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpidg
    wswlnayknryglvennihtqvrrpkasaywfkkvathnrl