PDB entry 4b15

View 4b15 on RCSB PDB site
Description: crystal structure of tamarind chitinase like lectin (TCLL)
Class: hydrolase
Keywords: hydrolase, n-acetyl glucosamine binding lectin, inactive chitinase, class III chitinase homologs, chilectins
Deposited on 2012-07-06, released 2013-06-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-06-12, with a file datestamp of 2013-06-07.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.14796
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase like lectin
    Species: TAMARINDUS INDICA [TaxId:58860]
    Database cross-references and differences (RAF-indexed):
    • PDB 4B15 (0-265)
    Domains in SCOPe 2.04: d4b15a_
  • Heterogens: ACT, MPD, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4b15A (A:)
ggnivvywgqggsdnsegslkeacksghynmivleelitydngrdpdlnlgahcvnctsl
qqeikycqlklikillqigqvtptkedtkdttkdlsqyldsnffsgksgplgevyldgid
iasvpeglnlkfdelvqalndsatsrriylsaspncvypdyyldkaiqtqkldflfvqff
yalpciytqglpedlfqamktwtsnvpeskifmalpatpdlngyipprvlnkeilpavtq
asnfagvmifdryfdrfrkysskikr