PDB entry 4axm

View 4axm on RCSB PDB site
Description: triazine cathepsin inhibitor complex
Class: hydrolase
Keywords: hydrolase
Deposited on 2012-06-13, released 2013-05-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-12, with a file datestamp of 2013-06-07.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.19124
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4axma_
  • Chain 'B':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4axmb_
  • Chain 'F':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4axmf_
  • Chain 'I':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4axmi_
  • Chain 'L':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4axml_
  • Chain 'O':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4axmo_
  • Heterogens: GOL, V65, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4axmA (A:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4axmA (A:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfessdnnky
    wlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4axmB (B:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4axmB (B:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestednnk
    ywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4axmF (F:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4axmF (F:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesnnkywl
    vknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4axmI (I:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4axmI (I:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestnnkyw
    lvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4axmL (L:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4axmL (L:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesnnkywl
    vknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4axmO (O:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4axmO (O:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesnnkywl
    vknswgeewgmggyvkmakdrrnhcgiasaasyptv