PDB entry 4aw4

View 4aw4 on RCSB PDB site
Description: Engineered variant of Listeria monocytogenes InlB internalin domain with an additional leucine rich repeat inserted
Class: protein binding
Keywords: protein binding, lrr, protein engineering, receptor binding, protein protein interaction, cell invasion, virulence factor, hgf receptor ligand, c-met ligand
Deposited on 2012-05-31, released 2012-08-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.16771
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: internalin b
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25147 (88-End)
      • insertion (66-87)
    Domains in SCOPe 2.06: d4aw4a1, d4aw4a2
  • Chain 'B':
    Compound: internalin b
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25147 (88-End)
      • insertion (66-87)
    Domains in SCOPe 2.06: d4aw4b1, d4aw4b2
  • Chain 'C':
    Compound: internalin b
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25147 (88-End)
      • insertion (66-87)
    Domains in SCOPe 2.06: d4aw4c1
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4aw4A (A:)
    gametitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvq
    giqylpnltslnlsnnqitdispiqylpnvtklflngnkltdikplanlknlgwlflden
    kvkdlsslkdlkklkslslehngisdinglvhlpqleslylgnnkitditvlsrltkldt
    lslednqisdivplagltklqnlylsknhisdlralaglknldvlelfsqeclnkpinhq
    snlvvpntvkntdgslvtpeiisddgdyekpnvkwhlpeftnevsfifyqpvtigkakar
    fhgrvtqplke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aw4A (A:)
    etitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq
    ylpnltslnlsnnqitdispiqylpnvtklflngnkltdikplanlknlgwlfldenkvk
    dlsslkdlkklkslslehngisdinglvhlpqleslylgnnkitditvlsrltkldtlsl
    ednqisdivplagltklqnlylsknhisdlralaglknldvlelfsqeclnkpinhqsnl
    vvpntvkntdgslvtpeiisddgdyekpnvkwnevsfifyqpvtigkakarfhgrvtqpl
    k
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4aw4B (B:)
    gametitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvq
    giqylpnltslnlsnnqitdispiqylpnvtklflngnkltdikplanlknlgwlflden
    kvkdlsslkdlkklkslslehngisdinglvhlpqleslylgnnkitditvlsrltkldt
    lslednqisdivplagltklqnlylsknhisdlralaglknldvlelfsqeclnkpinhq
    snlvvpntvkntdgslvtpeiisddgdyekpnvkwhlpeftnevsfifyqpvtigkakar
    fhgrvtqplke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aw4B (B:)
    etitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq
    ylpnltslnlsnnqitdispiqylpnvtklflngnkltdikplanlknlgwlfldenkvk
    dlsslkdlkklkslslehngisdinglvhlpqleslylgnnkitditvlsrltkldtlsl
    ednqisdivplagltklqnlylsknhisdlralaglknldvlelfsqeclnkpinhqsnl
    vvpntvkntdgslvtpeiisddgdyekpnvkwhlpeftnevsfifyqpvtigkakarfhg
    rvtqplk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4aw4C (C:)
    gametitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvq
    giqylpnltslnlsnnqitdispiqylpnvtklflngnkltdikplanlknlgwlflden
    kvkdlsslkdlkklkslslehngisdinglvhlpqleslylgnnkitditvlsrltkldt
    lslednqisdivplagltklqnlylsknhisdlralaglknldvlelfsqeclnkpinhq
    snlvvpntvkntdgslvtpeiisddgdyekpnvkwhlpeftnevsfifyqpvtigkakar
    fhgrvtqplke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aw4C (C:)
    etitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq
    ylpnltslnlsnnqitdispiqylpnvtklflngnkltdikplanlknlgwlfldenkvk
    dlsslkdlkklkslslehngisdinglvhlpqleslylgnnkitditvlsrltkldtlsl
    ednqisdivplagltklqnlylsknhisdlralaglknldvlelfsqeclnkpinhqsnl
    vvpntvkntdgslvtpeiisddgdyekpnvkwhlpeftnevsfifyqpvtigkakarfhg
    rvtqplk