PDB entry 4avp

View 4avp on RCSB PDB site
Description: Crystal structure of the DNA-binding domain of human ETV1.
Class: transcription
Keywords: transcription, transcriptional activation and repression, DNA binding protein, e twenty-six, erwing sarcoma, prostate cancer, melanoma, gastrointestinal stromal tumour
Deposited on 2012-05-28, released 2012-06-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-06-10, with a file datestamp of 2015-06-05.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ets translocation variant 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4avpa_
  • Chain 'B':
    Compound: ets translocation variant 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4avpb_
  • Chain 'C':
    Compound: ets translocation variant 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4avpc_
  • Chain 'D':
    Compound: ets translocation variant 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4avpd_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4avpA (A:)
    smgptsqrrgslqlwqflvallddpsnshfiawtgrgmefkliepeevarrwgiqknrpa
    mnydklsrslryyyekgimqkvageryvykfvcdpealfsmafsdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4avpA (A:)
    slqlwqflvallddpsnshfiawtgrgmefkliepeevarrwgiqknrpamnydklsrsl
    ryyyekgimqkvageryvykfvcdpealfsmaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4avpB (B:)
    smgptsqrrgslqlwqflvallddpsnshfiawtgrgmefkliepeevarrwgiqknrpa
    mnydklsrslryyyekgimqkvageryvykfvcdpealfsmafsdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4avpB (B:)
    slqlwqflvallddpsnshfiawtgrgmefkliepeevarrwgiqknrpamnydklsrsl
    ryyyekgimqkvageryvykfvcdpealfsmaf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4avpC (C:)
    smgptsqrrgslqlwqflvallddpsnshfiawtgrgmefkliepeevarrwgiqknrpa
    mnydklsrslryyyekgimqkvageryvykfvcdpealfsmafsdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4avpC (C:)
    slqlwqflvallddpsnshfiawtgrgmefkliepeevarrwgiqknrpamnydklsrsl
    ryyyekgimqkvageryvykfvcdpealfsmaf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4avpD (D:)
    smgptsqrrgslqlwqflvallddpsnshfiawtgrgmefkliepeevarrwgiqknrpa
    mnydklsrslryyyekgimqkvageryvykfvcdpealfsmafsdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4avpD (D:)
    slqlwqflvallddpsnshfiawtgrgmefkliepeevarrwgiqknrpamnydklsrsl
    ryyyekgimqkvageryvykfvcdpealfsmaf