PDB entry 4aux

View 4aux on RCSB PDB site
Description: Tet repressor class D in complex with 9-nitrotetracycline
Class: transcription
Keywords: transcription, transcription regulation, antibiotic
Deposited on 2012-05-22, released 2012-05-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.21275
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracycline repressor protein class d
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4auxa1, d4auxa2
  • Heterogens: XTC, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4auxA (A:)
    arlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv