PDB entry 4atl

View 4atl on RCSB PDB site
Description: Crystal structure of Raucaffricine glucosidase in complex with Glucose
Class: hydrolase
Keywords: hydrolase, alkaloid
Deposited on 2012-05-08, released 2013-01-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: 0.1743
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Raucaffricine-O-beta-D-glucosidase
    Species: RAUVOLFIA SERPENTINA [TaxId:4060]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4atla_
  • Chain 'B':
    Compound: Raucaffricine-O-beta-D-glucosidase
    Species: RAUVOLFIA SERPENTINA [TaxId:4060]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4atlb_
  • Heterogens: BGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4atlA (A:)
    matqssavidsndatrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpd
    mirggtngdvavdsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyy
    nnlidgllangikpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkh
    wmtlnepwtfsvhgyatglyapgrgrtspehvnhptvqhrcstvapqcicstgnpgtepy
    wvthhlllahaaavelyknkfqrgqegqigishatqwmepwdensasdveaaaraldfml
    gwfmepitsgdypksmkkfvgsrlpkfspeqskmlkgsydfvglnyytasyvtnastnss
    gsnnfsyntdihvtyetdrngvpigpqsgsdwlliypegirkilvytkktynvpliyvte
    ngvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvnvkgyfawslldnfewgeg
    ygvrfgiihidyndnfarypkdsavwlmnsfhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4atlA (A:)
    ndatrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpdmirggtngdva
    vdsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyynnlidgllang
    ikpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkhwmtlnepwtfs
    vhgyatglyapgrgrstgnpgtepywvthhlllahaaavelyknkfqrgqegqigishat
    qwmepwdensasdveaaaraldfmlgwfmepitsgdypksmkkfvgsrlpkfspeqskml
    kgsydfvglnyytasyvtnasnfsyntdihvtyetdrngvpigpqsgsdwlliypegirk
    ilvytkktynvpliyvtengvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvn
    vkgyfawslldnfewgegygvrfgiihidyndnfarypkdsavwlmnsfh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4atlB (B:)
    matqssavidsndatrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpd
    mirggtngdvavdsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyy
    nnlidgllangikpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkh
    wmtlnepwtfsvhgyatglyapgrgrtspehvnhptvqhrcstvapqcicstgnpgtepy
    wvthhlllahaaavelyknkfqrgqegqigishatqwmepwdensasdveaaaraldfml
    gwfmepitsgdypksmkkfvgsrlpkfspeqskmlkgsydfvglnyytasyvtnastnss
    gsnnfsyntdihvtyetdrngvpigpqsgsdwlliypegirkilvytkktynvpliyvte
    ngvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvnvkgyfawslldnfewgeg
    ygvrfgiihidyndnfarypkdsavwlmnsfhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4atlB (B:)
    ndatrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpdmirggtngdva
    vdsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyynnlidgllang
    ikpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkhwmtlnepwtfs
    vhgyatglyapgrgrstgnpgtepywvthhlllahaaavelyknkfqrgqegqigishat
    qwmepwdensasdveaaaraldfmlgwfmepitsgdypksmkkfvgsrlpkfspeqskml
    kgsydfvglnyytasyvtnasnfsyntdihvtyetdrngvpigpqsgsdwlliypegirk
    ilvytkktynvpliyvtengvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvn
    vkgyfawslldnfewgegygvrfgiihidyndnfarypkdsavwlmnsfh