PDB entry 4atd

View 4atd on RCSB PDB site
Description: Crystal structure of native Raucaffricine glucosidase
Class: hydrolase
Keywords: alkaloid, hydrolase
Deposited on 2012-05-05, released 2013-01-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.17524
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Raucaffricine-O-beta-D-glucosidase
    Species: RAUVOLFIA SERPENTINA [TaxId:4060]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4atda_
  • Chain 'B':
    Compound: Raucaffricine-O-beta-D-glucosidase
    Species: RAUVOLFIA SERPENTINA [TaxId:4060]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4atdb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4atdA (A:)
    matqssavidsndatrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpd
    mirggtngdvavdsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyy
    nnlidgllangikpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkh
    wmtlnepwtfsvhgyatglyapgrgrtspehvnhptvqhrcstvapqcicstgnpgtepy
    wvthhlllahaaavelyknkfqrgqegqigishatqwmepwdensasdveaaaraldfml
    gwfmepitsgdypksmkkfvgsrlpkfspeqskmlkgsydfvglnyytasyvtnastnss
    gsnnfsyntdihvtyetdrngvpigpqsgsdwlliypegirkilvytkktynvpliyvte
    ngvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvnvkgyfawslldnfewgeg
    ygvrfgiihidyndnfarypkdsavwlmnsfhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4atdA (A:)
    datrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpdmirggtngdvav
    dsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyynnlidgllangi
    kpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkhwmtlnepwtfsv
    hgyatglyapgrgrtgnpgtepywvthhlllahaaavelyknkfqrgqegqigishatqw
    mepwdensasdveaaaraldfmlgwfmepitsgdypksmkkfvgsrlpkfspeqskmlkg
    sydfvglnyytasyvtnasnfsyntdihvtyetdrngvpigpqsgsdwlliypegirkil
    vytkktynvpliyvtengvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvnvk
    gyfawslldnfewgegygvrfgiihidyndnfarypkdsavwlmnsfhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4atdB (B:)
    matqssavidsndatrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpd
    mirggtngdvavdsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyy
    nnlidgllangikpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkh
    wmtlnepwtfsvhgyatglyapgrgrtspehvnhptvqhrcstvapqcicstgnpgtepy
    wvthhlllahaaavelyknkfqrgqegqigishatqwmepwdensasdveaaaraldfml
    gwfmepitsgdypksmkkfvgsrlpkfspeqskmlkgsydfvglnyytasyvtnastnss
    gsnnfsyntdihvtyetdrngvpigpqsgsdwlliypegirkilvytkktynvpliyvte
    ngvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvnvkgyfawslldnfewgeg
    ygvrfgiihidyndnfarypkdsavwlmnsfhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4atdB (B:)
    datrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpdmirggtngdvav
    dsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyynnlidgllangi
    kpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkhwmtlnepwtfsv
    hgyatglyapgrgrtgnpgtepywvthhlllahaaavelyknkfqrgqegqigishatqw
    mepwdensasdveaaaraldfmlgwfmepitsgdypksmkkfvgsrlpkfspeqskmlkg
    sydfvglnyytasyvtnasnfsyntdihvtyetdrngvpigpqsgsdwlliypegirkil
    vytkktynvpliyvtengvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvnvk
    gyfawslldnfewgegygvrfgiihidyndnfarypkdsavwlmnsfhk