PDB entry 4at6

View 4at6 on RCSB PDB site
Description: Fab fragment of antiporphyrin antibody 14H7
Class: immune system
Keywords: immune system, metalloporphyrin, catalytic antibody, peroxidase
Deposited on 2012-05-04, released 2012-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fab 14h7 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AT6 (Start-216)
  • Chain 'B':
    Compound: fab 14h7 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AT6 (0-211)
    Domains in SCOPe 2.07: d4at6b1, d4at6b2
  • Chain 'C':
    Compound: fab 14h7 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AT6 (Start-216)
  • Chain 'D':
    Compound: fab 14h7 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AT6 (0-211)
    Domains in SCOPe 2.07: d4at6d1, d4at6d2
  • Chain 'E':
    Compound: fab 14h7 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AT6 (Start-216)
  • Chain 'F':
    Compound: fab 14h7 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AT6 (0-211)
    Domains in SCOPe 2.07: d4at6f1, d4at6f2
  • Chain 'G':
    Compound: fab 14h7 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AT6 (Start-216)
  • Chain 'H':
    Compound: fab 14h7 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AT6 (Start-216)
  • Chain 'I':
    Compound: fab 14h7 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AT6 (0-211)
    Domains in SCOPe 2.07: d4at6i1, d4at6i2
  • Chain 'J':
    Compound: fab 14h7 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AT6 (Start-216)
  • Chain 'K':
    Compound: fab 14h7 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AT6 (0-211)
    Domains in SCOPe 2.07: d4at6k1, d4at6k2
  • Chain 'L':
    Compound: fab 14h7 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AT6 (0-211)
    Domains in SCOPe 2.07: d4at6l1, d4at6l2
  • Chain 'M':
    Compound: fab 14h7 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AT6 (Start-216)
  • Chain 'N':
    Compound: fab 14h7 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AT6 (0-211)
    Domains in SCOPe 2.07: d4at6n1, d4at6n2
  • Chain 'O':
    Compound: fab 14h7 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AT6 (Start-216)
  • Chain 'P':
    Compound: fab 14h7 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AT6 (0-211)
    Domains in SCOPe 2.07: d4at6p1, d4at6p2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4at6B (B:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqetpdhlftgliggtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsra
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4at6D (D:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqetpdhlftgliggtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsra
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4at6F (F:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqetpdhlftgliggtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsra
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4at6I (I:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqetpdhlftgliggtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsra
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4at6K (K:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqetpdhlftgliggtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsra
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4at6L (L:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqetpdhlftgliggtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsra
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4at6N (N:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqetpdhlftgliggtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsra
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4at6P (P:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqetpdhlftgliggtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsra