PDB entry 4asi

View 4asi on RCSB PDB site
Description: Crystal structure of human ACACA C-terminal domain
Class: ligase
Keywords: ligase, protein
Deposited on 2012-05-01, released 2012-08-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.20367
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetyl-CoA carboxylase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4asia1, d4asia2
  • Chain 'B':
    Compound: Acetyl-CoA carboxylase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4asib1, d4asib2
  • Chain 'C':
    Compound: Acetyl-CoA carboxylase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4asic1, d4asic2
  • Chain 'D':
    Compound: Acetyl-CoA carboxylase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4asid1, d4asid2
  • Chain 'E':
    Compound: Acetyl-CoA carboxylase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4asie1, d4asie2
  • Chain 'F':
    Compound: Acetyl-CoA carboxylase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4asif1, d4asif2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4asiA (A:)
    smlintpyvtkdllqskrfqaqslgttyiydipemfrqsliklwesmstqaflpspplps
    dmltytelvlddqgqlvhmnrlpggneigmvawkmtfkspeypegrdiivigndityrig
    sfgpqedllflraselaraegipriyvsansgariglaeeirhmfhvawvdpedpykgyr
    ylyltpqdykrvsalnsvhcehvedegesrykitdiigkeegigpenlrgsgmiagessl
    ayneiitislvtcraigigaylvrlgqrtiqvenshliltgagalnkvlgrevytsnnql
    ggiqimhnngvthctvcddfegvftvlhwlsympksvhssvpllnskdpidriiefvptk
    tpydprwmlagrphptqkgqwlsgffdygsfseimqpwaqtvvvgrarlggipvgvvave
    trtvelsipadpanldseakiiqqagqvwfpdsafktyqaikdfnreglplmvfanwrgf
    sggmkdmydqvlkfgayivdglreccqpvlvyippqaelrggswvvidssinprhmemya
    dresrgsvlepegtveikfrrkdlvktmrrvdpvyihlaerlgtpelstaerkelenklk
    ereeflipiyhqvavqfadlhdtpgrmqekgvisdildwktsrtffywrlrrllledlvk
    kkihnanpeltdgqiqamlrrwfvevegtvkayvwdnnkdlaewlekqlteedgvhsvie
    enikcisrdyvlkqirslvqanpevamdsiihmtqhisptqraeviril
    

    Sequence, based on observed residues (ATOM records): (download)
    >4asiA (A:)
    dllqskrfqaqslgttyiydipemfrqsliklwesmstqaflpspplpsdmltytelvld
    dqgqlvhmnrlpggneigmvawkmtfkspeypegrdiivigndityrigsfgpqedllfl
    raselaraegipriyvsansgariglaeeirhmfhvawvdpedpykgyrylyltpqdykr
    vsalnsvhcehvedegesrykitdiigkeegigpenlrgsgmiagesslayneiitislv
    tcraigigaylvrlgqrtiqvenshliltgagalnkvlgrevytsnnqlggiqimhnngv
    thctvcddfegvftvlhwlsympksvhssvpllnskdpidriiefvptktpydprwmlag
    rphptqkgqwlsgffdygsfseimqpwaqtvvvgrarlggipvgvvavetrtvelsipad
    panldseakiiqqagqvwfpdsafktyqaikdfnreglplmvfanwrgfsggmkdmydqv
    lkfgayivdglreccqpvlvyippqaelrggswvvidssinprhmemyadresrgsvlep
    egtveikfrrkdlvktmrrvdpvyihlaerlgtpelstaerkelenklkereeflipiyh
    qvavqfadlhdtpgrmqekgvisdildwktsrtffywrlrrllledlvkkkihnanpelt
    dgqiqamlrrwfvevegtvkayvwdnnkdlaewlekqltvieenikcisrdyvlkqirsl
    vqanpevamdsiihmtqhisptqraeviril
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4asiB (B:)
    smlintpyvtkdllqskrfqaqslgttyiydipemfrqsliklwesmstqaflpspplps
    dmltytelvlddqgqlvhmnrlpggneigmvawkmtfkspeypegrdiivigndityrig
    sfgpqedllflraselaraegipriyvsansgariglaeeirhmfhvawvdpedpykgyr
    ylyltpqdykrvsalnsvhcehvedegesrykitdiigkeegigpenlrgsgmiagessl
    ayneiitislvtcraigigaylvrlgqrtiqvenshliltgagalnkvlgrevytsnnql
    ggiqimhnngvthctvcddfegvftvlhwlsympksvhssvpllnskdpidriiefvptk
    tpydprwmlagrphptqkgqwlsgffdygsfseimqpwaqtvvvgrarlggipvgvvave
    trtvelsipadpanldseakiiqqagqvwfpdsafktyqaikdfnreglplmvfanwrgf
    sggmkdmydqvlkfgayivdglreccqpvlvyippqaelrggswvvidssinprhmemya
    dresrgsvlepegtveikfrrkdlvktmrrvdpvyihlaerlgtpelstaerkelenklk
    ereeflipiyhqvavqfadlhdtpgrmqekgvisdildwktsrtffywrlrrllledlvk
    kkihnanpeltdgqiqamlrrwfvevegtvkayvwdnnkdlaewlekqlteedgvhsvie
    enikcisrdyvlkqirslvqanpevamdsiihmtqhisptqraeviril
    

    Sequence, based on observed residues (ATOM records): (download)
    >4asiB (B:)
    dllqskrfqaqslgttyiydipemfrqsliklwesmstqaflpspplpsdmltytelvld
    dqgqlvhmnrlpggneigmvawkmtfkspeypegrdiivigndityrigsfgpqedllfl
    raselaraegipriyvsansgariglaeeirhmfhvawvdpedpykgyrylyltpqdykr
    vsalnsvhcehvedegesrykitdiigkeegigpenlrgsgmiagesslayneiitislv
    tcraigigaylvrlgqrtiqvenshliltgagalnkvlgrevytsnnqlggiqimhnngv
    thctvcddfegvftvlhwlsympksvhssvpllnskdpidriiefvptktpydprwmlag
    rphptqkgqwlsgffdygsfseimqpwaqtvvvgrarlggipvgvvavetrtvelsipad
    panldseakiiqqagqvwfpdsafktyqaikdfnreglplmvfanwrgfsggmkdmydqv
    lkfgayivdglreccqpvlvyippqaelrggswvvidssinprhmemyadresrgsvlep
    egtveikfrrkdlvktmrrvdpvyihlaerlgtpelstaerkelenklkereeflipiyh
    qvavqfadlhdtpgrmqekgvisdildwktsrtffywrlrrllledlvkkkihnanpelt
    dgqiqamlrrwfvevegtvkayvwdnnkdlaewlekqltsvieenikcisrdyvlkqirs
    lvqanpevamdsiihmtq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4asiC (C:)
    smlintpyvtkdllqskrfqaqslgttyiydipemfrqsliklwesmstqaflpspplps
    dmltytelvlddqgqlvhmnrlpggneigmvawkmtfkspeypegrdiivigndityrig
    sfgpqedllflraselaraegipriyvsansgariglaeeirhmfhvawvdpedpykgyr
    ylyltpqdykrvsalnsvhcehvedegesrykitdiigkeegigpenlrgsgmiagessl
    ayneiitislvtcraigigaylvrlgqrtiqvenshliltgagalnkvlgrevytsnnql
    ggiqimhnngvthctvcddfegvftvlhwlsympksvhssvpllnskdpidriiefvptk
    tpydprwmlagrphptqkgqwlsgffdygsfseimqpwaqtvvvgrarlggipvgvvave
    trtvelsipadpanldseakiiqqagqvwfpdsafktyqaikdfnreglplmvfanwrgf
    sggmkdmydqvlkfgayivdglreccqpvlvyippqaelrggswvvidssinprhmemya
    dresrgsvlepegtveikfrrkdlvktmrrvdpvyihlaerlgtpelstaerkelenklk
    ereeflipiyhqvavqfadlhdtpgrmqekgvisdildwktsrtffywrlrrllledlvk
    kkihnanpeltdgqiqamlrrwfvevegtvkayvwdnnkdlaewlekqlteedgvhsvie
    enikcisrdyvlkqirslvqanpevamdsiihmtqhisptqraeviril
    

    Sequence, based on observed residues (ATOM records): (download)
    >4asiC (C:)
    dllqskrfqaqslgttyiydipemfrqsliklwesmstqaflpspplpsdmltytelvld
    dqgqlvhmnrlpggneigmvawkmtfkspeypegrdiivigndityrigsfgpqedllfl
    raselaraegipriyvsansgariglaeeirhmfhvawvdpedpykgyrylyltpqdykr
    vsalnsvhcehvedegesrykitdiigkeegigpenlrgsgmiagesslayneiitislv
    tcraigigaylvrlgqrtiqvenshliltgagalnkvlgrevytsnnqlggiqimhnngv
    thctvcddfegvftvlhwlsympksvhssvpllnskdpidriiefvptktpydprwmlag
    rphptqkgqwlsgffdygsfseimqpwaqtvvvgrarlggipvgvvavetrtvelsipad
    panldseakiiqqagqvwfpdsafktyqaikdfnreglplmvfanwrgfsggmkdmydqv
    lkfgayivdglreccqpvlvyippqaelrggswvvidssinprhmemyadresrgsvlep
    egtveikfrrkdlvktmrrvdpvyihlaerlgtpelstaerkelenklkereeflipiyh
    qvavqfadlhdtpgrmqekgvisdildwktsrtffywrlrrllledlvkkkihnanpelt
    dgqiqamlrrwfvevegtvkayvwdnnkdlaewlekqltgvhsvieenikcisrdyvlkq
    irslvqanpevamdsiihmtqhisptqraeviril
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4asiD (D:)
    smlintpyvtkdllqskrfqaqslgttyiydipemfrqsliklwesmstqaflpspplps
    dmltytelvlddqgqlvhmnrlpggneigmvawkmtfkspeypegrdiivigndityrig
    sfgpqedllflraselaraegipriyvsansgariglaeeirhmfhvawvdpedpykgyr
    ylyltpqdykrvsalnsvhcehvedegesrykitdiigkeegigpenlrgsgmiagessl
    ayneiitislvtcraigigaylvrlgqrtiqvenshliltgagalnkvlgrevytsnnql
    ggiqimhnngvthctvcddfegvftvlhwlsympksvhssvpllnskdpidriiefvptk
    tpydprwmlagrphptqkgqwlsgffdygsfseimqpwaqtvvvgrarlggipvgvvave
    trtvelsipadpanldseakiiqqagqvwfpdsafktyqaikdfnreglplmvfanwrgf
    sggmkdmydqvlkfgayivdglreccqpvlvyippqaelrggswvvidssinprhmemya
    dresrgsvlepegtveikfrrkdlvktmrrvdpvyihlaerlgtpelstaerkelenklk
    ereeflipiyhqvavqfadlhdtpgrmqekgvisdildwktsrtffywrlrrllledlvk
    kkihnanpeltdgqiqamlrrwfvevegtvkayvwdnnkdlaewlekqlteedgvhsvie
    enikcisrdyvlkqirslvqanpevamdsiihmtqhisptqraeviril
    

    Sequence, based on observed residues (ATOM records): (download)
    >4asiD (D:)
    dllqskrfqaqslgttyiydipemfrqsliklwesmstqaflpspplpsdmltytelvld
    dqgqlvhmnrlpggneigmvawkmtfkspeypegrdiivigndityrigsfgpqedllfl
    raselaraegipriyvsansgariglaeeirhmfhvawvdpedpykgyrylyltpqdykr
    vsalnsvhcehvedegesrykitdiigkeegigpenlrgsgmiagesslayneiitislv
    tcraigigaylvrlgqrtiqvenshliltgagalnkvlgrevytsnnqlggiqimhnngv
    thctvcddfegvftvlhwlsympksvhssvpllnskdpidriiefvptktpydprwmlag
    rphptqkgqwlsgffdygsfseimqpwaqtvvvgrarlggipvgvvavetrtvelsipad
    panldseakiiqqagqvwfpdsafktyqaikdfnreglplmvfanwrgfsggmkdmydqv
    lkfgayivdglreccqpvlvyippqaelrggswvvidssinprhmemyadresrgsvlep
    egtveikfrrkdlvktmrrvdpvyihlaerlgtpelstaerkelenklkereeflipiyh
    qvavqfadlhdtpgrmqekgvisdildwktsrtffywrlrrllledlvkkkihnanpelt
    dgqiqamlrrwfvevegtvkayvwdnnkdlaewlekqltvieenikcisrdyvlkqirsl
    vqanpevamdsiihmtqhraeviri
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4asiE (E:)
    smlintpyvtkdllqskrfqaqslgttyiydipemfrqsliklwesmstqaflpspplps
    dmltytelvlddqgqlvhmnrlpggneigmvawkmtfkspeypegrdiivigndityrig
    sfgpqedllflraselaraegipriyvsansgariglaeeirhmfhvawvdpedpykgyr
    ylyltpqdykrvsalnsvhcehvedegesrykitdiigkeegigpenlrgsgmiagessl
    ayneiitislvtcraigigaylvrlgqrtiqvenshliltgagalnkvlgrevytsnnql
    ggiqimhnngvthctvcddfegvftvlhwlsympksvhssvpllnskdpidriiefvptk
    tpydprwmlagrphptqkgqwlsgffdygsfseimqpwaqtvvvgrarlggipvgvvave
    trtvelsipadpanldseakiiqqagqvwfpdsafktyqaikdfnreglplmvfanwrgf
    sggmkdmydqvlkfgayivdglreccqpvlvyippqaelrggswvvidssinprhmemya
    dresrgsvlepegtveikfrrkdlvktmrrvdpvyihlaerlgtpelstaerkelenklk
    ereeflipiyhqvavqfadlhdtpgrmqekgvisdildwktsrtffywrlrrllledlvk
    kkihnanpeltdgqiqamlrrwfvevegtvkayvwdnnkdlaewlekqlteedgvhsvie
    enikcisrdyvlkqirslvqanpevamdsiihmtqhisptqraeviril
    

    Sequence, based on observed residues (ATOM records): (download)
    >4asiE (E:)
    lqskrfqaqslgttyiydipemfrqsliklwesmstqaflpspplpsdmltytelvlddq
    gqlvhmnrlpggneigmvawkmtfkspeypegrdiivigndityrigsfgpqedllflra
    selaraegipriyvsansgariglaeeirhmfhvawvdpedpykgyrylyltpqdykrvs
    alnsvhcehvedegesrykitdiigkeegigpenlrgsgmiagesslayneiitislvtc
    raigigaylvrlgqrtiqvenshliltgagalnkvlgrevytsnnqlggiqimhnngvth
    ctvcddfegvftvlhwlsympksvhssvpllnskdpidriiefvptktpydprwmlagrp
    hptqkgqwlsgffdygsfseimqpwaqtvvvgrarlggipvgvvavetrtvelsipadpa
    nldseakiiqqagqvwfpdsafktyqaikdfnreglplmvfanwrgfsggmkdmydqvlk
    fgayivdglreccqpvlvyippqaelrggswvvidssinprhmemyadresrgsvlepeg
    tveikfrrkdlvktmrrvdpvyihlaerlgtpelstaerkelenklkereeflipiyhqv
    avqfadlhdtpgrmqekgvisdildwktsrtffywrlrrllledlvkkkihnanpeltdg
    qiqamlrrwfvevegtvkayvwdnnkdlaewlekqlsvieenikcisrdyvlkqirslvq
    a
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4asiF (F:)
    smlintpyvtkdllqskrfqaqslgttyiydipemfrqsliklwesmstqaflpspplps
    dmltytelvlddqgqlvhmnrlpggneigmvawkmtfkspeypegrdiivigndityrig
    sfgpqedllflraselaraegipriyvsansgariglaeeirhmfhvawvdpedpykgyr
    ylyltpqdykrvsalnsvhcehvedegesrykitdiigkeegigpenlrgsgmiagessl
    ayneiitislvtcraigigaylvrlgqrtiqvenshliltgagalnkvlgrevytsnnql
    ggiqimhnngvthctvcddfegvftvlhwlsympksvhssvpllnskdpidriiefvptk
    tpydprwmlagrphptqkgqwlsgffdygsfseimqpwaqtvvvgrarlggipvgvvave
    trtvelsipadpanldseakiiqqagqvwfpdsafktyqaikdfnreglplmvfanwrgf
    sggmkdmydqvlkfgayivdglreccqpvlvyippqaelrggswvvidssinprhmemya
    dresrgsvlepegtveikfrrkdlvktmrrvdpvyihlaerlgtpelstaerkelenklk
    ereeflipiyhqvavqfadlhdtpgrmqekgvisdildwktsrtffywrlrrllledlvk
    kkihnanpeltdgqiqamlrrwfvevegtvkayvwdnnkdlaewlekqlteedgvhsvie
    enikcisrdyvlkqirslvqanpevamdsiihmtqhisptqraeviril
    

    Sequence, based on observed residues (ATOM records): (download)
    >4asiF (F:)
    lqskrfqaqslgttyiydipemfrqsliklwesmstqaflpspplpsdmltytelvlddq
    gqlvhmnrlpggneigmvawkmtfkspeypegrdiivigndityrigsfgpqedllflra
    selaraegipriyvsansgariglaeeirhmfhvawvdpedpykgyrylyltpqdykrvs
    alnsvhcehvedegesrykitdiigkeegigpenlrgsgmiagesslayneiitislvtc
    raigigaylvrlgqrtiqvenshliltgagalnkvlgrevytsnnqlggiqimhnngvth
    ctvcddfegvftvlhwlsympksvhssvpllnskdpidriiefvptktpydprwmlagrp
    hptqkgqwlsgffdygsfseimqpwaqtvvvgrarlggipvgvvavetrtvelsipadpa
    nldseakiiqqagqvwfpdsafktyqaikdfnreglplmvfanwrgfsggmkdmydqvlk
    fgayivdglreccqpvlvyippqaelrggswvvidssinprhmemyadresrgsvlepeg
    tveikfrrkdlvktmrrvdpvyihlaerlgtpelstaerkelenklkereeflipiyhqv
    avqfadlhdtpgrmqekgvisdildwktsrtffywrlrrllledlvkkkihnanpeltdg
    qiqamlrrwfvevegtvkayvwdnnkdlaewlekqlieenikcisrdyvlkqirslvq