PDB entry 4ary

View 4ary on RCSB PDB site
Description: Lepidopteran-specific toxin Cry1Ac in complex with receptor specificity determinant GalNAc
Class: toxin
Keywords: toxin, membrane pore-forming toxin, insecticidal protein, lepidopteran specificity, carbohydrate recognition, manduca sexta, aminopeptidase n
Deposited on 2012-04-27, released 2013-05-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.21669
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pesticidal crystal protein cry1ac
    Species: Bacillus thuringiensis serovar kurstaki [TaxId:29339]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4arya1, d4arya2, d4arya3
  • Chain 'B':
    Compound: pesticidal crystal protein cry1ac
    Species: Bacillus thuringiensis serovar kurstaki [TaxId:29339]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4aryb1, d4aryb2, d4aryb3
  • Chain 'C':
    Compound: pesticidal crystal protein cry1ac
    Species: Bacillus thuringiensis serovar kurstaki [TaxId:29339]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4aryc1, d4aryc2, d4aryc3
  • Chain 'D':
    Compound: pesticidal crystal protein cry1ac
    Species: Bacillus thuringiensis serovar kurstaki [TaxId:29339]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4aryd1, d4aryd2, d4aryd3
  • Heterogens: NGA, 13D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4aryA (A:)
    tgytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqriee
    farnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaiplfav
    qnyqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyavrw
    yntglervwgpdsrdwvrynqfrreltltvldivalfpnydsrrypirtvsqltreiytn
    pvlenfdgsfrgsaqgiersirsphlmdilnsitiytdahrgyyywsghqimaspvgfsg
    peftfplygtmgnaapqqrivaqlgqgvyrtlsstlyrrpfniginnqqlsvldgtefay
    gtssnlpsavyrksgtvdsldeippqnnnvpprqgfshrlshvsmfrsgfsnssvsiira
    pmfswihrsaefnniiasdsitqipavkgnflfngsvisgpgftggdlvrlnssgnniqn
    rgyievpihfpststryrvrvryasvtpihlnvnwgnssifsntvpatatsldnlqssdf
    gyfesanaftsslgnivgvrnfsgtagviidrfefipvtat
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aryA (A:)
    tgytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqriee
    farnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaiplfav
    qnyqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyavrw
    yntglervwgpdsrdwvrynqfrreltltvldivalfpnydsrrypirtvsqltreiytn
    pvlenfdgsfrgsaqgiersirsphlmdilnsitiytdahrgyyywsghqimaspvgfsg
    peftfplygtmgnaapqqrivaqlgqgvyrtlsstlyrrpfniginnqqlsvldgtefay
    gtssnlpsavyrksgtvdsldeippqnnnvpprqgfshrlshvsmfrsgfsnssvsiira
    pmfswihrsaefnniiasdsitqipavkgnflfngsvisgpgftggdlvrlnssgnniqn
    rgyievpihfpststryrvrvryasvtpihlnvnwgnssifsntvpatatsldnlqssdf
    gyfesanaftsslgnivgvrnfsgtagviidrfefipvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4aryB (B:)
    tgytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqriee
    farnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaiplfav
    qnyqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyavrw
    yntglervwgpdsrdwvrynqfrreltltvldivalfpnydsrrypirtvsqltreiytn
    pvlenfdgsfrgsaqgiersirsphlmdilnsitiytdahrgyyywsghqimaspvgfsg
    peftfplygtmgnaapqqrivaqlgqgvyrtlsstlyrrpfniginnqqlsvldgtefay
    gtssnlpsavyrksgtvdsldeippqnnnvpprqgfshrlshvsmfrsgfsnssvsiira
    pmfswihrsaefnniiasdsitqipavkgnflfngsvisgpgftggdlvrlnssgnniqn
    rgyievpihfpststryrvrvryasvtpihlnvnwgnssifsntvpatatsldnlqssdf
    gyfesanaftsslgnivgvrnfsgtagviidrfefipvtat
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aryB (B:)
    gytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqrieef
    arnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaiplfavq
    nyqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyavrwy
    ntglervwgpdsrdwvrynqfrreltltvldivalfpnydsrrypirtvsqltreiytnp
    vlenfdgsfrgsaqgiersirsphlmdilnsitiytdahrgyyywsghqimaspvgfsgp
    eftfplygtmgnaapqqrivaqlgqgvyrtlsstlyrrpfniginnqqlsvldgtefayg
    tssnlpsavyrksgtvdsldeippqnnnvpprqgfshrlshvsmfrsgfsnssvsiirap
    mfswihrsaefnniiasdsitqipavkgnflfngsvisgpgftggdlvrlnssgnniqnr
    gyievpihfpststryrvrvryasvtpihlnvnwgnssifsntvpatatsldnlqssdfg
    yfesanaftsslgnivgvrnfsgtagviidrfefipvtat
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4aryC (C:)
    tgytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqriee
    farnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaiplfav
    qnyqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyavrw
    yntglervwgpdsrdwvrynqfrreltltvldivalfpnydsrrypirtvsqltreiytn
    pvlenfdgsfrgsaqgiersirsphlmdilnsitiytdahrgyyywsghqimaspvgfsg
    peftfplygtmgnaapqqrivaqlgqgvyrtlsstlyrrpfniginnqqlsvldgtefay
    gtssnlpsavyrksgtvdsldeippqnnnvpprqgfshrlshvsmfrsgfsnssvsiira
    pmfswihrsaefnniiasdsitqipavkgnflfngsvisgpgftggdlvrlnssgnniqn
    rgyievpihfpststryrvrvryasvtpihlnvnwgnssifsntvpatatsldnlqssdf
    gyfesanaftsslgnivgvrnfsgtagviidrfefipvtat
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aryC (C:)
    gytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqrieef
    arnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaiplfavq
    nyqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyavrwy
    ntglervwgpdsrdwvrynqfrreltltvldivalfpnydsrrypirtvsqltreiytnp
    vlenfdgsfrgsaqgiersirsphlmdilnsitiytdahrgyyywsghqimaspvgfsgp
    eftfplygtmgnaapqqrivaqlgqgvyrtlsstlyrrpfniginnqqlsvldgtefayg
    tssnlpsavyrksgtvdsldeippqnnnvpprqgfshrlshvsmfrsgfsnssvsiirap
    mfswihrsaefnniiasdsitqipavkgnflfngsvisgpgftggdlvrlnssgnniqnr
    gyievpihfpststryrvrvryasvtpihlnvnwgnssifsntvpatatsldnlqssdfg
    yfesanaftsslgnivgvrnfsgtagviidrfefipvt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4aryD (D:)
    tgytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqriee
    farnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaiplfav
    qnyqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyavrw
    yntglervwgpdsrdwvrynqfrreltltvldivalfpnydsrrypirtvsqltreiytn
    pvlenfdgsfrgsaqgiersirsphlmdilnsitiytdahrgyyywsghqimaspvgfsg
    peftfplygtmgnaapqqrivaqlgqgvyrtlsstlyrrpfniginnqqlsvldgtefay
    gtssnlpsavyrksgtvdsldeippqnnnvpprqgfshrlshvsmfrsgfsnssvsiira
    pmfswihrsaefnniiasdsitqipavkgnflfngsvisgpgftggdlvrlnssgnniqn
    rgyievpihfpststryrvrvryasvtpihlnvnwgnssifsntvpatatsldnlqssdf
    gyfesanaftsslgnivgvrnfsgtagviidrfefipvtat
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aryD (D:)
    gytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqrieef
    arnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaiplfavq
    nyqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyavrwy
    ntglervwgpdsrdwvrynqfrreltltvldivalfpnydsrrypirtvsqltreiytnp
    vlenfdgsfrgsaqgiersirsphlmdilnsitiytdahrgyyywsghqimaspvgfsgp
    eftfplygtmgnaapqqrivaqlgqgvyrtlsstlyrrpfniginnqqlsvldgtefayg
    tssnlpsavyrksgtvdsldeippqnnnvpprqgfshrlshvsmfrsgfsnssvsiirap
    mfswihrsaefnniiasdsitqipavkgnflfngsvisgpgftggdlvrlnssgnniqnr
    gyievpihfpststryrvrvryasvtpihlnvnwgnssifsntvpatatsldnlqssdfg
    yfesanaftsslgnivgvrnfsgtagviidrfefipvt